KEGG   Flavobacterium johnsoniae UW101: Fjoh_0506Help
Entry
Fjoh_0506         CDS       T00508                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
fjo  Flavobacterium johnsoniae UW101
Pathway
fjo00380  Tryptophan metabolism
fjo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fjo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    Fjoh_0506
Enzymes [BR:fjo01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     Fjoh_0506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ABQ03541
UniProt: A5FMM4
LinkDB All DBs
Position
complement(532774..534051)
Genome map
AA seq 425 aa AA seqDB search
MTFQNTREFAKQLDAQDALNHYQEQFIFPKVNDKRVIYFTGNSLGLQPKRTKAYIDEVMN
DWAELAVEGHFYAEKPWWDYQERFSEPLSKIVGALPSEVTVMNTLTVNLHLLMVSFYQPK
GKRYKIICEEKAFPSDQYMFQSQVHFHGYKPEDAIVEIKRREGEHNIRLEDVLAKIEEVG
DELALVLIGGVNYYTGQVFDIKTITAAGQKAGAKVGWDLAHAAGNIKLELHDWNVDFAAW
CSYKYMNSGPGNASGVFVHERHHNDPDLPRFAGWWGHNKERRFKMEPNFDPVHGAGGWQI
SNLPVLSLAPYLASVEMFAEVGMDALIAKRDHITSYLEFILHEIDKEVESTFEIITPSNP
EERASQLSVFLHGEGRSLFDYLMKNGVITDWREPNVIRLAPVPLYCSYEDMYDFGQILKK
GILGK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacttttcaaaatacacgcgaatttgcgaaacaacttgatgcacaagatgcattgaat
cattatcaagaacaatttatatttccaaaggttaacgataaacgagtaatttactttaca
ggaaattcattaggattacagccaaaacgtaccaaagcttatatagatgaagtaatgaat
gactgggcagaactggctgttgaaggtcatttttatgccgaaaaaccttggtgggattat
caggaaagattttctgaaccgttgagtaaaattgtaggtgcacttccgtcagaagttacg
gttatgaatactttgactgtgaaccttcatttattgatggtttccttttatcagccaaaa
ggaaaacgctataaaattatctgtgaagaaaaagcattcccatcagatcaatatatgttt
caaagtcaggttcattttcatggatacaaaccagaagatgcaatcgtagaaatcaaacgc
cgcgaaggcgaacataatattcgtctggaagacgttttagccaaaattgaagaagttggc
gacgaattggctttggttttaattggcggcgtaaactattatacaggacaggtttttgat
attaaaacgataaccgcagccggacaaaaagccggagcaaaagtaggatgggatttagca
cacgcagctggaaatatcaaattagaacttcatgactggaatgtagattttgcagcatgg
tgcagttataaatatatgaattcaggaccaggaaatgcttcgggagttttcgttcacgaa
agacatcataacgatcctgatttaccacgttttgctggttggtggggacataataaagaa
cgtcgttttaaaatggaacctaactttgatcctgttcatggagcaggcgggtggcagatt
agcaatctgccagttctgtcattagcgccttatttagcatctgtagaaatgtttgctgaa
gttggaatggatgctttaattgcaaagcgtgatcatattacttcttacttagaatttatt
ctacatgaaattgataaagaagtagaaagcactttcgaaatcattacgccttcaaaccca
gaagaaagagcatcgcaattatctgttttcctgcatggcgaaggaagaagtttatttgat
tatttgatgaaaaacggagtcattacagactggcgcgaaccaaacgtaattcgtctggcg
ccagttcctttgtattgttcttatgaagatatgtacgattttgggcagatcttgaaaaaa
ggaattttagggaaataa

DBGET integrated database retrieval system