KEGG   Flavobacterium johnsoniae UW101: Fjoh_0586Help
Entry
Fjoh_0586         CDS       T00508                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
fjo  Flavobacterium johnsoniae UW101
Pathway
fjo00240  Pyrimidine metabolism
fjo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fjo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Fjoh_0586
Enzymes [BR:fjo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Fjoh_0586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22
Motif
Other DBs
NCBI-ProteinID: ABQ03621
UniProt: A5FME9
LinkDB All DBs
Position
complement(625275..625859)
Genome map
AA seq 194 aa AA seqDB search
MFLENTVNHKEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQRVEIFKPAIDTRYHDEM
VVSHDANEIRSTPVPAAANISILAQGCDVVGIDEAQFFDDEIVTVCNDLANRGVRVIVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAVCTRTGNLANYSFRKTDNDKLVMLGETEEYEP
LSRAAYFNAMKKNQ
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgaaaatacagtaaatcacaaagaacaatttggttggattgaagttatttgt
ggatcaatgttttcgggtaaaaccgaagaattaatccgcagattaaagcgcgcacagttt
gccaaacaaagagttgaaatctttaaacccgctatcgatacccgttatcatgacgaaatg
gtagtgtcgcatgatgctaatgaaattcgttcaaccccagttccggctgcagccaatatt
tctattttggcgcagggatgcgatgttgtcggaattgatgaggctcagttttttgatgat
gaaattgtaacagtttgtaatgatctcgcaaatcgcggtgttcgtgtaatcgtggccgga
cttgacatggattttaagggaaatccatttggaccaatgccggcacttatggcaacagca
gaatatgttacgaaagtccatgctgtttgtaccagaaccggaaatctggctaattatagt
tttagaaaaacagataatgataagcttgtaatgcttggtgaaaccgaggaatatgagccg
cttagccgtgcagcgtattttaatgcaatgaaaaaaaatcagtaa

DBGET integrated database retrieval system