KEGG   Flavobacterium johnsoniae UW101: Fjoh_0779Help
Entry
Fjoh_0779         CDS       T00508                                 

Definition
(GenBank) Candidate beta-galactosidase; Glycoside hydrolase family 2
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
fjo  Flavobacterium johnsoniae UW101
Pathway
fjo00052  Galactose metabolism
fjo00511  Other glycan degradation
fjo00600  Sphingolipid metabolism
fjo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fjo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Fjoh_0779
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    Fjoh_0779
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Fjoh_0779
Enzymes [BR:fjo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Fjoh_0779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Glyco_hydro_2_N DUF4982 Glyco_hydro_2 BetaGal_dom4_5
Motif
Other DBs
NCBI-ProteinID: ABQ03813
UniProt: A5FLV7
LinkDB All DBs
Position
complement(865012..867495)
Genome map
AA seq 827 aa AA seqDB search
MLQLTSYKKLGLLFAGFLLLTACKSSTDQKFSNRKVSFNADWSFHLNDSIADKDTIGAGT
KWRTLDVPHDWSIEGKFDEKSPGGYGGGSLNGGLGWYKKTFKVAAEDSTKVTSITFDGVY
KNSEVWVNGHYLGKRPNGYIGFQYEITPYLNYGDKNNEIIVKVDNSKQPNSRWYSGSGIF
RNVWLETTDKLHVGQWGTYITTPKVTAEKASVSIETTIKNQYKEGKKATVTTTIFKEDKK
VTSVTQDITINASENQTLNQSAEVENPILWSDENPELYTAVTEISLDDKIIDQYKTTFGI
RDFKFDLNKGFILNGKQVKIKGVCMHHDLGPLGSAINTRAIERQLEILKEMGVNGIRTSH
NPPAPELLELCDKMGFIVMDEAFDMWKQTKTKYDYGNDWDKWHKQDLIDQLLRDRNHASI
FMWSIGNEIPEQWSEKGVEIAKELAAITRQYDKTRPLTAGMNPPVNMNIDAVTLQFEKKD
VSINPLAGSGVLDLIGYNYAHQTFEHHLENFPKTPFIATETTSGLQTRGYYDAVSDTIKK
WPVRWDLKFTEGNPGNTVSAYDQVQTPWGSTHEATWKIIKKHDFLAGMYVWTGFDYIGEP
TPYEWPSVSSYFGIVDLAGFPKDVYYMYQSEWTDKTVLHIFPHWNWKAGQTVDVWAYYNK
ADEVELFVNGKSVGKRSKKGDDLHVMWRIPFEAGTLKAVSRKDGKVVLEKEIKTAGNPSQ
LKLTADRSTIKADKNDLSFITVDILDDKGTIAPNANNEINFSLKGNGKIVGVCSGDPVSH
ESYKGNKHTALAGKCLVIVQSGDKSGRLELTAKANGLKQSTIVITTE
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atgttgcagctaacttcatataaaaaactaggattactatttgcaggctttcttttattg
acagcatgcaagtcatcaacagatcaaaaatttagtaaccgaaaagtttcttttaatgca
gattggagtttccaccttaacgacagtattgcagataaagatactattggagcgggaaca
aaatggagaactttagacgttccgcatgattggagtatcgaaggaaaatttgatgaaaaa
agtcctggcggttatggcggaggatcgcttaacggaggtttgggctggtacaaaaaaaca
tttaaagtagctgcagaagacagcacaaaagtaacttcaatcacttttgacggtgtttac
aaaaacagtgaagtctgggtaaacggacattatttaggaaaacgtccaaacggatatatt
ggttttcaatatgaaattacgccgtacttaaattacggagacaaaaacaacgaaataatt
gttaaggttgacaattcaaaacaacctaattcacgctggtattcgggttcaggaattttt
agaaatgtttggcttgagaccacagataaacttcatgtaggacaatggggaacgtatatt
acaactccaaaagttacagccgaaaaagcttcagtaagtattgaaaccacaataaaaaat
caatacaaagaaggtaaaaaagcaacggtaactaccaccatttttaaagaagataaaaaa
gtaacatcagttactcaagatataacaatcaacgccagcgaaaatcaaacgctgaatcaa
tcggcggaagttgaaaatccgattttatggtcagatgaaaaccctgaattgtacacagca
gttaccgaaatttcacttgacgataaaatcattgatcaatataaaaccactttcggaatt
agagattttaaattcgatttgaacaaaggttttattttgaatggaaaacaagtcaaaata
aaaggtgtttgtatgcaccacgatttaggaccattaggttctgcgatcaacacgcgtgca
atcgaacgtcagttagaaattttgaaagaaatgggcgtaaacggaatcagaacttctcat
aatccgcctgctccagagcttttagaactctgcgataaaatgggtttcattgttatggat
gaagcttttgatatgtggaaacagaccaaaaccaaatacgattacggaaacgattgggac
aaatggcacaaacaagatttaatcgatcaactgcttcgcgaccgaaatcatgccagtatt
tttatgtggagtattggaaatgaaattccggaacaatggagtgaaaaaggtgttgaaatt
gcgaaagaattggccgcaattacacgtcaatatgacaaaacacgaccgttgactgcagga
atgaatccgccagtaaacatgaatattgatgccgtgactttacaatttgagaaaaaggat
gtttcgattaatccgcttgctggatctggagttttagatttaattggatacaattatgcg
catcaaacttttgaacatcatttggaaaactttccaaaaacaccttttatcgcaactgaa
actacttcaggtttacagacaagaggatattacgatgccgtttcagatactatcaaaaaa
tggccggtaagatgggatcttaaatttacagaaggaaatcctggaaataccgtttcggct
tacgaccaagtgcaaacgccttggggatctacacacgaagcgacttggaaaatcattaaa
aaacacgatttcttggcaggaatgtatgtttggacaggcttcgattatatcggagaacca
actccttatgaatggccgtctgttagttcctatttcggaattgtcgatttagcaggtttt
ccgaaagacgtgtattatatgtaccaaagcgaatggacagataaaaccgttttgcacatt
ttcccacattggaactggaaagccggacaaactgttgatgtttgggcatactacaataaa
gccgatgaggtggaactttttgtaaacggaaaatcagttggaaaaagaagtaaaaaagga
gacgatttacatgtgatgtggagaattccttttgaagctggaactctaaaagcagtttct
cgtaaagacggaaaagtggttttagaaaaagaaatcaaaacagctggaaatccttctcaa
ttaaaattaactgcggatagaagcactataaaagcagacaaaaacgatttgtcatttatc
acagttgatattttagatgataaaggaacgattgcaccaaatgcgaataacgaaattaat
ttctctttaaaaggaaatggaaaaattgtaggcgtttgcagcggagacccagtaagtcac
gagtcttacaaaggaaataaacataccgctttggctggaaaatgtttggttattgtacaa
tctggagataaatcaggaagattggaattaaccgcaaaagcaaacggattgaaacaatca
acaattgtaattactactgaatga

DBGET integrated database retrieval system