KEGG   Flavobacterium johnsoniae UW101: Fjoh_1318Help
Entry
Fjoh_1318         CDS       T00508                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
fjo  Flavobacterium johnsoniae UW101
Pathway
fjo00473  D-Alanine metabolism
fjo01100  Metabolic pathways
fjo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:fjo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Fjoh_1318
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Fjoh_1318
Enzymes [BR:fjo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Fjoh_1318
Peptidoglycan biosynthesis and degradation proteins [BR:fjo01011]
 Precursor biosynthesis
  Racemase
   Fjoh_1318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: ABQ04350
UniProt: A5FKC2
LinkDB All DBs
Position
1508552..1511020
Genome map
AA seq 822 aa AA seqDB search
MSINLKSLIPVLNAEWTGSDTDIFVDHISIDSRSLQNGPQTLFIALSGANNDAHLYIAEL
IEKGVQNFAVQYIPENVKGKANFFVVKNTLKALQELAAYYRDLFDFPIIGLTGSNGKTIV
KEWLNFLLSPDYNIIRSPKSYNSQVGVPLSVIAINEKHNLGIFEAGISTVNEMVNLEKII
KPNIGVLTNIGSAHDEGFENLTQKINEKLLLFKKSAVIIYQKNELVDKCLLDFSAQYPLE
NRALFSWSFADASADVFILKKETKNDSTTIKYQYKDEIFNLEIPFSDSASIENAISCLLV
LLHFEYDFTIIQNRMEMLYPVEMRLEVKNGIHNCSLIDDSYSSDFQSLKIALDFLESQKK
NASKAVILSDIFQSGFSNEELYSKVAQLISDNKINRVIGIGTTISSFQDKFPNSTMFQNT
AAFIAEIENLNFNNETILIKGARSFQFEEIVSLLEEKTHETVLEINLDAINHNLNYFKSK
LADDVKIMVMVKAFGYGNGGLEIAKLLEHNKVNYLGVAFADEGISLKNGGIKLPIMVLNP
ESTSFPSIIQYKLEPEIYSIKGLNAFLKIAREKNLKDFPIHIKVDTGMHRLGFEDNTIDE
LIATLKGNSTVRVQSILSHLATSDDPKHFDFVEKQISLFERLSSKLISELNINPIRHILN
TSGISNFPDAQYNMVRLGIGLYGVSNDPAEQKYLENVGTLKSIISQVRTIPAGDSVGYGR
RFMADKETKIATIPIGYADGISRLWGNQIGFVTIKNQKAYIVGSVCMDMLMVDVSHIDCK
EGDSVIIFGESPTVIEMAEALKTIPYEIMTSISQRVKRVFFR
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgagcataaatttaaaaagcctgattccggttttaaatgccgagtggacaggctcagat
actgatatttttgtagatcatatttcgatcgacagccgttctttacaaaacggacctcaa
acattgtttattgctctttcgggcgcgaataatgacgctcatttatatattgccgaatta
atagaaaaaggcgttcagaattttgcagttcagtatataccagaaaatgtaaaaggaaaa
gccaatttttttgttgtaaaaaatacgctgaaagcattacaggaattagcagcctattat
cgtgatttattcgatttccctattattggtttaaccggaagcaacggaaaaaccatcgta
aaagaatggcttaattttcttttaagccctgattataatattatccgaagcccaaaaagt
tataactcacaagttggtgttccgctttctgttattgctataaatgaaaaacacaattta
ggaatttttgaagccggaatttcaacggttaacgaaatggttaatcttgagaaaattatc
aaaccaaatattggagttttaaccaatataggttctgcacacgatgaaggatttgaaaat
ctgactcagaaaatcaacgagaaattactgcttttcaaaaagtcagcagtaattatttat
caaaaaaatgaattggtagataaatgtcttttagacttttctgctcaatatccgctagaa
aacagagccttattttcatggagttttgcagatgcctctgcagatgtttttattctgaaa
aaagaaaccaaaaacgattcaaccacaataaaatatcaatataaagacgaaatttttaat
ttagaaattccgttcagcgattctgcttctatcgaaaatgccatttcatgtttattggtt
ttactgcattttgaatatgattttaccattattcaaaacagaatggaaatgctttatcca
gttgaaatgcgtcttgaagttaaaaacggaatccacaattgcagtttaatagacgatagt
tacagctccgattttcaatcgctgaaaatcgctttagattttctggaaagccagaaaaaa
aatgcttcaaaagccgttatactatcagatatttttcaaagcggattttcaaatgaagaa
ctgtattcaaaagtagcgcagttaatttcagataataaaataaaccgtgtcattggaatt
ggaactacaatttcatcttttcaagataagtttccaaacagtacgatgtttcaaaacacg
gctgcatttatcgccgaaattgaaaatttgaatttcaataatgaaaccatattgataaaa
ggcgcaagatcatttcagtttgaagaaattgtttcactgcttgaagaaaaaacgcatgaa
acagttctcgaaatcaatctggatgctataaatcacaatctgaattattttaaatcaaaa
ctggccgatgatgtaaaaatcatggttatggtcaaggcttttggttatggaaacggcgga
ctcgaaattgcaaaactgctcgaacataataaagtaaattatttaggtgtggctttcgcc
gatgaaggaatttcgctgaaaaatggcggcatcaaactgcctattatggttttgaatcca
gaatcgaccagctttccttcgataattcaatacaaacttgaacccgaaatttacagcata
aaaggtttaaatgcctttttgaaaatagccagagaaaagaacttaaaagattttcctatt
catataaaagtcgatacaggaatgcaccgtttaggttttgaggataatacgatcgacgaa
ttaattgcgactttaaaaggaaactcaaccgttcgtgttcaaagtattttatcgcatttg
gcaacgagcgatgatccgaagcattttgattttgtagaaaaacaaataagtttattcgaa
aggttatcttcaaaattaatctcagaattaaatataaatccaatccgccatattttaaac
acttccggaatcagtaatttcccagatgcacaatacaatatggtgcgtttagggattggt
ttgtatggcgtttccaacgatccggccgaacagaaatatctggaaaacgtaggcacctta
aaatcgattatttcgcaggttcgaactattccggcaggtgacagcgttggttacggacgc
cgttttatggcagataaagaaacaaaaattgcaaccattccaattggttatgcagacgga
atttcgagattatggggcaatcagattggttttgtaaccatcaaaaatcaaaaagcctat
atcgtaggaagtgtttgtatggatatgttaatggttgatgtaagtcatatagactgcaaa
gaaggcgattcggtaattattttcggcgaaagcccaacggttatagaaatggctgaagca
ttaaaaaccattccgtatgaaataatgaccagtatttcgcagcgtgtaaaacgagtattt
tttagatag

DBGET integrated database retrieval system