KEGG   Flavobacterium johnsoniae UW101: Fjoh_2806Help
Entry
Fjoh_2806         CDS       T00508                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
fjo  Flavobacterium johnsoniae UW101
Pathway
fjo00620  Pyruvate metabolism
fjo00680  Methane metabolism
fjo01100  Metabolic pathways
fjo01120  Microbial metabolism in diverse environments
fjo01200  Carbon metabolism
Module
fjo_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:fjo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Fjoh_2806
  09102 Energy metabolism
   00680 Methane metabolism
    Fjoh_2806
Enzymes [BR:fjo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Fjoh_2806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ABQ05828
UniProt: A5FG47
LinkDB All DBs
Position
3337915..3340500
Genome map
AA seq 861 aa AA seqDB search
MYTLPKIERFNKDVLSKYHIYNSVFITLPFDSIDNTGVLLPLFTETCETGFKKQETPKEI
FDFFSNKFLNNASETEKIDLMFRFIQYIERQIVLFDAIEDAAFPEVNNMEGRGSLRDIKE
KSDAKEKDDELVDFLESFNVRTVLTAHPTQFYPGPVLGIINDLTEAIRQNDLLQIKQLLA
QLGKTPFIQHEKPNPYDEAVSLIWYLENVFYATAGEIVHYLQKNLHDGNPIKNQLIKLGF
WPGGDRDGNPFVTTEITLKVADRLRTSILKCYYVEMRNLKRKLTFSGVDTLVSDLEHKLY
RSVFYSKGEIFITLDELLTQLNTIRTIIIEKHQSLYLDELEALLVKINLFGFHFATLDIR
QNSKIHNAVFKDVVNYYLNSGSDIFPKNYYDLTEDQKIDVLSKVQGNLNPADFENEITRS
TLESVQAIKTIQANNGEEGANRYIISNNESALNVMETFAMIRLNNWKNPTVDIIPLFESV
DDLQNAHQIMEQLYTNPEYSKHLKSRGNEQTIMLGFSDGTKDGGYLMANWSIYQAKISLT
EISRKYGIKAIFFDGRGGPPARGGGKTHKFYASLGPKIENKEIQITVQGQTISSNFGTLD
SCRFNIENLLSAGVTNQVFGKEKNELSAEETQILTQLADLGYEKYLSFKNHPKFIPYLEK
MSTLKYYSKTNIGSRPSKRSKSESLDFADLRAIPFVGSWSQLKQNVPGFFGVGTALKHFE
KSGQWHKVSDLYHNSLFFKTLLENSMMSLAKSFLPLTAYMRKDPEFGEFWQIIHDEFSET
KRLLLKIAGHKTLMENYPDGIASIQIRERIVLPLLTIQQYALSKINELNKESSPNEELIK
VYEKIVTRSLFGNTNASRNSA
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atgtacacgttgccaaaaatagaacgttttaacaaagacgttctttctaaatatcacatt
tacaatagtgttttcataacattaccatttgattctatagataacactggagttttactt
cctttatttacagaaacctgcgaaacgggatttaaaaaacaggaaacaccaaaagaaatt
tttgatttcttttcgaataagttcctaaacaatgcttcagaaactgagaaaatcgatctt
atgtttcgatttattcaatatattgagcgtcagattgtattatttgatgctattgaagat
gcagcttttcctgaagttaataatatggaaggacgcggctctttgcgagatattaaagaa
aaatcagacgctaaagaaaaagacgatgaactggtagatttcttagaaagctttaatgtc
cgtacagttttaacagcacacccaacacaattttatcctggaccggtacttggaattata
aatgatttgacagaagcaattcgtcagaacgatttattgcaaattaaacaattgcttgcg
cagctgggaaaaacaccttttattcagcatgaaaagccaaatccttacgacgaagcggta
agtttaatttggtaccttgaaaatgtattctatgctacggctggagaaattgtacattat
cttcaaaaaaatcttcacgatggaaacccaatcaagaaccaattgataaaacttggattc
tggcctggaggtgaccgcgacggaaatccttttgttacaacagaaattactcttaaagtt
gcagatcgtttaagaacttcaattttaaagtgctactatgttgaaatgagaaacttaaaa
agaaagctaactttctcaggtgtagatactttggtatctgatcttgaacataagctttac
cgttctgttttttattctaaaggtgaaattttcatcactttagatgaattattaacgcag
ttgaatactattcgtactataattattgaaaaacatcaatcattatatctagatgaatta
gaagcacttttagtaaaaattaatctattcggattccattttgctactttagatattcgt
cagaacagcaaaattcacaatgccgtatttaaagatgttgtgaattattatttgaattct
ggttcagatattttccctaagaattattatgatttaacagaagatcaaaaaatcgatgtt
ttatcaaaagtacaagggaatttaaatcctgccgattttgaaaacgaaattacaagatcg
actttagaatctgttcaggctatcaaaacgattcaggcaaacaatggtgaagaaggcgct
aatcgttacattatcagcaacaacgaaagtgctctgaatgtaatggagacttttgcaatg
atccgtttaaacaattggaaaaacccaacggttgatattattccgctttttgaatctgtt
gatgatctacagaatgcgcaccaaattatggagcagctgtatactaatccggaatattct
aagcatttaaaatcaagaggaaatgagcagacaattatgcttggtttctctgacgggaca
aaagacggcggttatttaatggctaactggagtatttatcaggcaaaaatttcgttgact
gaaatttcaagaaaatacggaatcaaagctattttctttgacggacgcggcggacctcct
gcacgaggcggtggaaaaacacataaattctacgcttcattagggccaaaaattgaaaat
aaagaaatccagataacggttcagggacaaactattagttctaattttggaactttagat
tcttgccgttttaatatcgaaaacttattaagtgccggtgttacgaatcaggtatttggt
aaagaaaagaatgaattatctgcagaagaaactcaaatcctgacacaattagctgattta
ggatatgagaagtatttgagctttaagaatcacccaaaatttattccttatttggaaaaa
atgagtacgttgaaatattattctaaaacaaacattggaagccgtccatcaaaaagaagt
aaatctgaatcattagattttgctgatttaagagcaattccgtttgtgggttcttggagt
cagttaaaacaaaatgtaccaggattttttggagtaggaacagctttaaaacattttgaa
aaatctggccagtggcacaaagtaagtgatttgtaccacaattcattgttctttaaaacc
ctgcttgaaaacagtatgatgtcattggctaaatcatttttaccattaacagcttacatg
agaaaagatcctgagtttggtgaattctggcagattatccatgatgaattctctgaaaca
aaacgtcttttattgaaaattgcgggtcataaaaccttaatggaaaattatcctgatggt
atagcttcaattcaaataagagaacgtattgtactgccattgttaacgatacaacaatat
gcattatcaaaaataaatgaattaaacaaagagagttctccaaacgaagagcttattaaa
gtgtacgagaaaattgtaacgagatctctttttggaaatacaaatgcaagtagaaattca
gcttaa

DBGET integrated database retrieval system