KEGG   Flavobacterium johnsoniae UW101: Fjoh_3487Help
Entry
Fjoh_3487         CDS       T00508                                 

Definition
(GenBank) putative ribonuclease BN
  KO
K07058  membrane protein
Organism
fjo  Flavobacterium johnsoniae UW101
Brite
KEGG Orthology (KO) [BR:fjo00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    Fjoh_3487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB Peptidase_M50
Motif
Other DBs
NCBI-ProteinID: ABQ06501
UniProt: A5FE63
LinkDB All DBs
Position
complement(4164402..4165325)
Genome map
AA seq 307 aa AA seqDB search
MSKEIEDRIEKLPVIRNAARLLKRIKLPWLEGFSLYDLLEMYTLGILEGAFSYHASAVSF
SFFMALFPFALFILNLIPFIPIDNFQEDFLQFVQQSVPPNTYDAISKIISDILNNSHSGL
LSSGFLLSIFLMANGINGILSGFESSKHVFDKRGFFRQYLVALAISLVMTVILFVTVATI
VVFEVFIQKTIIQDVLSDRIPLIILGRYLFVILMILITSSILLRYGTKQYNKVPFISIGS
VFTTVLIVISSFFFGIWVIKFSKYNELYGSIGTLLILMFYIWINCMILLLGFELNASIRK
LKQKKEK
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaagaaatagaggatcggattgaaaaactgcccgtaatacgcaacgcagcccga
cttttaaaaagaataaagctcccttggttagagggattttctttgtatgatttacttgaa
atgtacactttagggattcttgaaggtgctttttcatatcatgcaagcgctgtttctttc
agcttttttatggctttatttccttttgctttatttattttaaacttaattccgtttatt
ccgatagataattttcaggaagatttcctgcagtttgtacagcagagtgttcctccaaat
acgtatgatgctattagtaaaattatcagtgatattttaaataatagtcactcgggctta
ttatcgtcgggttttttactttctatttttttgatggcaaatggtattaacggaatttta
agcggttttgaatcgtctaaacacgtttttgataagagaggtttttttagacaatatttg
gttgctttggctatttcactcgttatgactgtaattttgtttgtaactgtggctacaatt
gtagtttttgaggttttcattcaaaaaacaattattcaggatgtattaagcgatcgtatt
ccactgattattttagggcgatatttattcgttattctgatgattttgataacatcttca
atattattacgttatggtacaaaacagtacaataaagtgccttttatcagcattggttct
gtttttacaacggtcttaattgttatatcttcgttcttttttggcatttgggttataaaa
ttctcaaaatataacgaactttatggttcaattggaacattattaattctaatgttttat
atttggataaactgtatgattctgcttttagggttcgaattgaatgcttctatcagaaaa
ttaaaacaaaaaaaagaaaaataa

DBGET integrated database retrieval system