KEGG   Flavobacterium johnsoniae UW101: Fjoh_4885Help
Entry
Fjoh_4885         CDS       T00508                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
fjo  Flavobacterium johnsoniae UW101
Pathway
fjo00564  Glycerophospholipid metabolism
fjo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fjo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Fjoh_4885
Enzymes [BR:fjo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Fjoh_4885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 GIDA HI0933_like FAD_binding_3 Thi4 Pyr_redox_2 NAD_binding_8 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ABQ07884
UniProt: A5FA78
LinkDB All DBs
Position
5906896..5908473
Genome map
AA seq 525 aa AA seqDB search
MNRSEQLLKLQNTENWDVIIIGGGASGLGTAIDAASRGYKTILLEAVDFAKGTSSRSTKL
VHGGVRYLAQGDVHLVREALKERGLLAQNANHLVKNQSFVIPNYHWLSGYFYTIGLKIYD
LLSGGLSLGSSKYLSKKKTIEMLPNVEEDGLVNGVIYHDGQFDDSRLAVNLAQTAVENGA
CVLNYTKVINLIKDDKNQITGVQAVDQETGINYNIKGAVVINATGVFTNAIMKLNDKVYK
KYIVPSQGIHLVFDKSFLPGEHALMIPKTKDGRVLFAVPWHNHVVVGTTDTLIKKQSLEP
IALESEIEFVLETAQRFLAKKPTRADVLSVFAGLRPLAAPKEEGRSTKEVSRSHKIIVSE
TGLITITGGKWTTYRKIAEDIIDKAILKGKLPKKPCITQNLSIHGNKPTTTLDRENHLYI
YGSDITKILQLQEKEPELKEKLHLDYEFTLAEIVWAVRYEMARTVDDILARRVRLLFLDA
RAAIEVSEKTARVIAKELGHDENWVAKEIADFKATSKGFFLSEFR
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgttcagagcagttactaaaactacaaaataccgaaaattgggacgtaataatt
ataggcggaggagccagcggtttaggaactgcaattgatgctgccagccgaggctataaa
accatcttacttgaagctgtagattttgccaaaggaacttccagcagaagtaccaaatta
gttcatggcggtgtacgatatttggcgcagggagatgtccacttagttagagaagcatta
aaagagcgaggtttactggcacaaaatgcaaatcatttggtaaaaaaccaatcttttgtt
attccaaattaccattggttaagcggttacttttacaccattggattaaaaatttatgat
ctattatcaggaggtttaagtttagggagttctaaatatctttccaaaaagaaaactatc
gaaatgcttccaaatgtagaagaagacggacttgtaaatggtgttatttatcatgacggg
caatttgacgattctcgtttggctgtaaatctggctcagactgcggtagaaaacggagct
tgtgttttaaattatacaaaagttattaatttaataaaagatgataaaaatcaaatcacc
ggcgttcaggcagttgatcaggaaaccggaataaactataacataaaaggtgcagttgta
ataaatgcaacaggagtttttacaaatgccatcatgaagctaaacgataaagtttacaaa
aaatatatcgtgccgagtcagggaattcatttggtgtttgataaatcttttcttccaggc
gaacatgctttgatgattccgaaaacaaaagatggaagagttttatttgctgttccgtgg
cacaatcacgttgtagtaggtacaaccgacactttaataaaaaaacaaagtttagaacct
attgctttagaaagcgaaattgaatttgttttagaaacagcacagcgattccttgccaaa
aaaccaacaagagccgatgtattatctgtttttgcaggtctgcgtccgttagctgctcca
aaagaagaaggcagaagcacaaaagaagtttccagaagtcataaaattatagtttcagaa
actggattgataaccataacaggaggtaaatggactacttaccgaaaaattgccgaagac
atcattgacaaagcaatactaaaaggaaaacttcccaaaaaaccttgtattacacaaaac
ttaagcattcacggaaataaacctacaacgactcttgatagggaaaaccacttgtatatt
tatggttctgatattacaaaaatactccagctgcaagaaaaagaaccagaattaaaagaa
aaactccatcttgattatgaatttacattggcagaaattgtttgggctgtacgttatgaa
atggcaagaactgtagatgatattctggcaagacgtgttcgattattgtttttggatgcc
agagctgcaattgaagtatctgaaaaaacagcaagggtaattgcaaaagaacttggacat
gatgaaaattgggtcgctaaggaaattgccgattttaaagcgacatctaaaggatttttt
ctctctgaatttcgataa

DBGET integrated database retrieval system