KEGG   Flavobacterium kingsejongi: FK004_02650Help
Entry
FK004_02650       CDS       T05683                                 

Definition
(GenBank) bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
fki  Flavobacterium kingsejongi
Pathway
fki00473  D-Alanine metabolism
fki01100  Metabolic pathways
fki01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:fki00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    FK004_02650
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    FK004_02650
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:fki01011]
    FK004_02650
Enzymes [BR:fki01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     FK004_02650
Peptidoglycan biosynthesis and degradation proteins [BR:fki01011]
 Precursor biosynthesis
  Racemase
   FK004_02650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AWG24198
UniProt: A0A2S1LKF0
LinkDB All DBs
Position
609593..612022
Genome map
AA seq 809 aa AA seqDB search
MSLNIQNIIPAIGAQFSGNPDATIDTVSIDSRSLQNNSGTLYFALSGQNHDGHEYLEELL
SKGVYNFVVTQYPEQLKGKANFLVVHNTLEALQLFAAYYRNAFDFPIIGVTGSNGKTIVK
EWLNFLLSPEYNIIRSPKSYNSQVGVPLSIIGINEKHNLGIFEAGISLVGEMAKLEVLIR
PTIGVLTNIGSAHNEGFQSREQKISEKLKLFKDAEILIYAKNPEVDALIPAGTKTWSWSF
TDPNADVQISQKGTQLHIHTSQHTFTVTLPFQDSSSVENAITCLMVLLYFGYSPAVIQER
LQLLYPVEMRLKVKNGINNTTLIDDSYNSDYQSLKIALDFLENQKQHQKKTVILSDIFQS
GWSNPTLYETVAALFSSNQIDRIIGIGDQITTHAHYFSNITTYATTADFFEAYDPLDFEN
ETILIKGARPFHFEEIVFRLEEKTHETVLEINLNAISHNLNFFKSKLQPGIKLMVMVKAF
GYGSGSFEIARLLEYHKVDYLGVAFADEGIALRNAGITMPIMIMNPETPSFSAIINFGLE
PEIYSVKELHAFLRVAAQHNVSDYPIHIKLDTGMHRLGFEAKDLDTLIAVIKDNPRVSIK
SVLSHLATSDEPEQRDFTLSQIARFDLLSSQLLSALHIQPLRHILNTSGISNFPHGQYDM
VRLGIGLYGVSNDENETKYLENVGTLKSVISQIRTIEAGESVGYGRKFIASATTVIATIP
IGYADGIRRSWGNEVGYLIVNHQKAPIVGNICMDMLMINITGIACHEGDTVTIFGENPSV
TIMAKALGTIPYEILTSISQRVKRVFYRE
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atgagcctaaacatccaaaatatcatcccggccatcggggcgcaattttcaggaaatcct
gatgccactatcgataccgtttctattgacagccgttcgctacaaaataattccggcacc
ctctacttcgccctttccggacaaaatcatgacgggcatgaatatctggaagagctcttg
tctaaaggcgtctacaatttcgtggttacccagtatccggagcagctcaaaggaaaagcg
aacttcctggttgtccacaatacccttgaggcactacagctgtttgccgcatattaccgt
aatgcatttgatttccccattattggcgtcaccggcagtaacggcaaaacaattgtcaaa
gaatggcttaatttcctgctgagtccggaatataatatcatccgaagccctaaaagctat
aattctcaggtaggcgtaccactttccattattgggattaatgaaaaacataaccttggg
atttttgaagctggaatttctttagtgggcgaaatggccaaactggaagtcctgattcgt
cccaccattggcgtactcaccaatatcggatcggctcataatgaagggtttcaaagccgc
gaacagaaaatcagcgagaaactgaaactttttaaagacgctgaaatcctgatctatgct
aaaaatccagaagtggatgccctaattcctgccggaacaaaaacctggagctggagtttt
accgatcccaatgccgatgtacagatcagccagaaagggacgcaactccatatccacaca
agccaacatacgtttaccgtaacgttgcctttccaggacagttcgtctgtagaaaatgcg
attacctgcctgatggtgttgttgtatttcggctatagtccggcagtgatccaggaacga
ctgcaactgctttatccggttgaaatgcgccttaaagtcaaaaatggcatcaataacact
actcttattgatgacagttataattccgactatcaatcgctgaaaattgcccttgatttc
ctggaaaaccaaaaacaacatcagaaaaagaccgtcatcctctccgatatttttcagagc
ggctggtcgaatcctacgctatacgaaacagtagcagccctcttttcttcgaatcagatt
gaccgtatcatcgggatcggggatcagatcactacgcatgcccattacttttccaatatc
accacttatgctactacggctgatttttttgaggcctatgatccgcttgattttgaaaac
gaaaccatcctgatcaaaggagcgcgcccttttcattttgaagagattgtatttcgcctt
gaagaaaaaacacacgaaacggttttggagattaacctgaatgctattagccataacctc
aatttcttcaaatccaaattacaaccgggcatcaaactgatggtcatggtaaaagctttt
ggctatggcagcggcagttttgaaattgcccggctgttggaataccacaaagtcgattac
ctgggtgtggcctttgccgacgaaggtatcgccctgagaaatgcaggaattactatgccc
atcatgattatgaatccggaaacgcccagtttttcagcgatcattaattttggcctcgag
ccggagatttattccgtaaaggaactgcatgctttcctgcgtgttgcagcacaacacaat
gtctccgactatccgatccacatcaaactggataccgggatgcaccgccttggttttgaa
gcaaaagacctggacacgttaattgctgtaataaaggataatccaagggttagcatcaaa
agtgtcttatcccatctggccaccagtgacgaaccggaacagcgtgattttaccctgtcc
cagatcgctcgctttgatttgctttccagccaattgctttcagcactccacatccaaccc
ttacgccatatcctgaatacttcgggaatcagcaatttcccacacgggcaatacgatatg
gtccgcctgggcattgggctgtacggggtatcgaatgatgagaatgagacgaaatacctc
gaaaatgtaggaaccctaaaatcggtcatttcccagatccggaccatcgaagcaggcgaa
agtgtgggctacggccggaagtttatcgcaagtgctactactgtcattgctaccatccca
attggctatgctgatggcatccgcagaagctggggcaatgaggtcggttacctaatcgtc
aaccaccaaaaagcacctattgtcgggaacatctgtatggacatgctgatgattaatatc
accggaattgcatgccatgaaggggatacggttactatttttggcgaaaatccatcggta
acaataatggcaaaagccctgggaaccatcccttatgaaatcctgaccagtatttcgcaa
cgggtaaaacgtgttttttacagagaataa

DBGET integrated database retrieval system