KEGG   Flavobacterium kingsejongi: FK004_07975Help
Entry
FK004_07975       CDS       T05683                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
fki  Flavobacterium kingsejongi
Pathway
fki00380  Tryptophan metabolism
fki01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fki00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    FK004_07975
Enzymes [BR:fki01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     FK004_07975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1 SHMT
Motif
Other DBs
NCBI-ProteinID: AWG25176
UniProt: A0A2S1LNH1
LinkDB All DBs
Position
1836255..1837529
Genome map
AA seq 424 aa AA seqDB search
MTYKNTREFAQQLDSEDQLKHYREEFLFPQVNGKQVIYFTGNSLGLQPKRAKKYVDEVMN
DWANLAVEGHFYAEKPWWDYQERFAKPLSKIVGALPAEVTVMNTLTVNLHLMMVSFYRPT
AKRYKIICESKAFPSDQYMIQSQVHFHGLDPKEAIVEIERRPGEHNIRLEDVLAKINAIG
DELALVLIGGVNYYTGQVFDMKTITKAGHDAGAYVGWDLAHAAGNIKLELHDWDVDFAAW
CSYKYMNSGPGNASGLFVHEKHHHNPDLPRFAGWWGHNKERRFKMEPKFDPVHGAEGWQI
SNLPILSLAPYLASVDMFDEIGMDKLIEKRDKITAYLEFILHEIDKEVASTFEIITPENK
EERASQLSVFLHGEGRSLFDYLMKNGVITDWREPNVIRLAPVPLYCSFEDMYEFGQILKK
GITG
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgacctataaaaatacacgtgaatttgcgcaacagctcgattcagaagaccagctaaaa
cactatcgggaagaatttctttttccacaggtaaacggtaagcaagtaatttactttacc
ggaaactctttgggattacaaccaaagcgggccaaaaaatatgtagatgaagtgatgaat
gactgggcaaatttggctgtagaaggtcatttttatgccgaaaaaccatggtgggattac
caggagcgttttgcaaaaccattgagtaaaattgtgggagcacttcctgctgaagttacg
gtgatgaatacacttacggttaatttacacctgatgatggtttctttttacaggcctaca
gcgaaacgctataaaatcatctgtgagtccaaagcttttccaagtgatcaatatatgatc
cagagccaggtgcattttcacggactggatcctaaggaggctattgtggaaatagagcga
agaccaggagagcacaacatccgcctggaagatgtattggctaaaattaatgcaatagga
gacgaactcgctttggttttaataggtggggtaaattattatacgggtcaggtattcgat
atgaaaacgataaccaaagccgggcatgacgcaggtgcttatgtaggttgggatcttgcc
catgctgcagggaatatcaagctggaattgcacgactgggatgtcgattttgcagcctgg
tgtagctataaatatatgaattccggaccaggaaatgcttcgggattatttgtgcacgaa
aagcaccaccacaatccggatcttccacgatttgcaggatggtggggacataataaggaa
agacgttttaaaatggagccaaaattcgatccggtacatggagcagaaggctggcaaatc
agtaacctgccgatcctttcactggcgccttatttggcttccgtggatatgttcgacgaa
atcggaatggataagctgattgagaaaagagataagatcacggcttacctcgaatttata
ttgcatgaaatcgataaggaagtagcgagtacttttgagattattacgccagaaaataaa
gaggaaagagcctcgcaactttctgttttcctgcatggagaaggccgaagcctgtttgat
tacctgatgaaaaacggtgtgatcacagactggagggaacccaatgtaattcgtttggct
cctgttccattatactgttcttttgaggatatgtatgagttcgggcagattttgaaaaaa
ggaattacaggataa

DBGET integrated database retrieval system