KEGG   Flavobacterium kingsejongi: FK004_11575
Entry
FK004_11575       CDS       T05683                                 

Definition
(GenBank) hypothetical protein
Organism
fki  Flavobacterium kingsejongi
SSDB
Other DBs
NCBI-ProteinID: AWG25814
UniProt: A0A2S1LPZ2
LinkDB
Position
2605724..2606629
AA seq 301 aa
MEQDITVLKQQVNFNLRAEVLFYELQNILKKETQVFVRHNGISKRHNSRDAIDISTMLYQ
EDSRITKEALVLHLAKNSIYHNLPELLFHPLSVSNPTMSNKEIVEAVKENKETENDVLDF
FMPFDNEIFSANSDATIRSLHLFDDKIDLFLTIVDELVAIEFELTAIQKKNLFIYLCESE
KLKENLPELEKVLEMLLGNAVKLKYKKHVFTTSPFLKLSAGILGFNLGLCGAVESEIDDV
EVALYFDGNINYSILQYKMTLTRKVLEYFIISNRKIDIVFFNNYQFGIKLNENYLGINTI
L
NT seq 906 nt   +upstreamnt  +downstreamnt
atggagcaagatattactgttttaaaacaacaagttaattttaatttgagagccgaagtt
cttttttatgaattgcaaaatattttaaaaaaagaaacccaagtttttgtgagacacaat
gggatttcaaaaagacacaattctagggatgcaattgacatctctacgatgttgtatcaa
gaagattcacgaataaccaaagaagcacttgtcttacatttagcaaaaaacagcatttat
cacaatttacctgaattactttttcatccattgtcagttagtaatccaacaatgtctaac
aaagagattgtggaagctgtcaaagaaaataaagaaactgaaaatgatgttttagatttt
ttcatgccttttgataatgaaattttttctgccaattcggacgctacgataagaagcctt
cacttatttgatgataagattgatttgtttttaactatagtagatgagttagtagctatc
gaatttgaattgacagcaatccaaaaaaagaatttatttatctatttatgtgaatctgaa
aagttaaaagaaaaccttccagaattagaaaaagttttagaaatgctattaggcaatgca
gtaaaattgaaatacaaaaaacatgtctttacaacgtctccctttctaaaactaagcgca
ggtattttgggttttaatttaggcctatgcggagctgtagaaagtgaaatagatgatgta
gaagttgccttgtattttgatggaaatattaattattccattttacagtataagatgaca
cttacccgtaaagtgctggaatattttattattagtaatagaaaaattgatattgtattt
tttaataactatcagtttggaataaaactaaacgaaaactatttaggtattaataccatt
ttataa

DBGET integrated database retrieval system