KEGG   Flavobacterium kingsejongi: FK004_15300Help
Entry
FK004_15300       CDS       T05683                                 

Definition
(GenBank) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
fki  Flavobacterium kingsejongi
Pathway
fki00220  Arginine biosynthesis
fki01100  Metabolic pathways
fki01110  Biosynthesis of secondary metabolites
fki01130  Biosynthesis of antibiotics
fki01210  2-Oxocarboxylic acid metabolism
fki01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fki00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    FK004_15300
Enzymes [BR:fki01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     FK004_15300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AWG26490
UniProt: A0A2S1LRV4
LinkDB All DBs
Position
3368947..3370047
Genome map
AA seq 366 aa AA seqDB search
MTTKTITQLTQEAIALLKQLIATPSFSSEEDQTALHIENWMTTNAIIFQRDQNNIWATNL
HYDPKKPNLLLNSHHDTVKPNQGYTLNPFEAIEKDGKIFGLGSNDAGGCLVSLLATFTHF
YKSEDLPYNLIMAATAEEESSGPNGLNSLLKLLPEIDCAIVGEPTEMQLAIAEKGLLVLD
VTVEGIAGHAAHPNDQNPIYKALPVIQWFESYPFEKVSEVLGPVKMTVTQINAGKQHNVV
PAECQLVVDVRVNDCYSNIEILEHIQQQVKAIVKPRSLHLNASSIAKSHRLVQAGIALGR
STYGSPTLSDQSVLSCQSLKLGPGQSPRSHTADEFIYRSEIEEGIQLYTAILSDFFNNTK
AASASA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgactaccaaaacgattacacaactcacacaggaagccatagccttactcaaacagctt
attgccacgccttctttttcatctgaagaagaccagacagcgttgcacattgaaaactgg
atgactaccaacgctattattttccaaagagatcaaaataacatttgggcaaccaacctg
cactatgatcctaaaaagccaaacctgctccttaactcccatcacgataccgtaaaaccc
aatcagggctacaccctcaatccgtttgaagcgatcgaaaaagacggaaagatctttggc
ctgggcagtaatgatgctggaggctgccttgtttcgctattggccacctttacccacttt
tacaaaagcgaagacttgccatacaacctgattatggccgctacagcagaagaagaaagc
agcggccccaatggactcaacagcctgcttaaattattacccgagattgattgtgctatt
gtaggcgaacctaccgaaatgcagctcgctattgccgaaaaagggctattggtacttgat
gtgactgtagaaggtattgcgggccatgctgcacatcccaatgaccaaaatcctatatac
aaggcattacctgtaattcagtggttcgaaagttacccgtttgaaaaagtatccgaagtc
ctgggccctgtaaaaatgactgtaacccagatcaatgccggaaagcaacacaatgttgtt
cctgccgaatgccaattggttgtagatgttcgtgtaaacgattgttacagcaacatcgaa
atactggaacacatccaacagcaggtcaaagcaattgttaagccacgctccttacacctg
aatgcttcttccatcgccaaaagccacagattggtacaggctggaattgcattaggacgg
agcacttatggctccccaacgctttcggatcagtcagtgctcagctgccagtctttaaag
ctaggcccaggccagtcaccccgctcccacactgctgacgaattcatttaccgcagtgaa
atcgaagaaggcatccaattatataccgctatactaagcgattttttcaataacaccaag
gctgcatccgcatccgcataa

DBGET integrated database retrieval system