KEGG   Flavobacterium kingsejongi: FK004_17820Help
Entry
FK004_17820       CDS       T05683                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
fki  Flavobacterium kingsejongi
Pathway
fki00620  Pyruvate metabolism
fki00680  Methane metabolism
fki01100  Metabolic pathways
fki01120  Microbial metabolism in diverse environments
fki01200  Carbon metabolism
Module
fki_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:fki00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    FK004_17820
  09102 Energy metabolism
   00680 Methane metabolism
    FK004_17820
Enzymes [BR:fki01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     FK004_17820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AWG26957
UniProt: A0A2S1LT79
LinkDB All DBs
Position
complement(3916680..3919265)
Genome map
AA seq 861 aa AA seqDB search
MYTPTKMERFNNNVLLKYQLFNSIFITLPFDSIDNTGALLPLFSECCEAGFKKGDSPKDI
VNGFSERYLENASEQQKIDIMFRFIQYVERQVVLFDAIEDASFAVVHNLEGTGSLRNIKE
KAESNNKMGKLREVLDDFKIRTVLTAHPTQFYPGSVLGIITDLTAAIKQNDLNSIRQLLA
QLGKTPFIKKEKPTPFDEAVSLTWYLENVFYYSIGEILQYFQKNILGGELKDNAIVNLGF
WPGGDRDGNPFVTTDITLKVAARLRSSILKCYYKDIRALKRKLTFSKIDAIVLDVEQKLY
RSVFYSDGEIFITVAEFKAKLKEIRVLLINEKQSLYIDDINDLINKVDVFGFYFATLDIR
QNSKIHDGVFKNIVAETQKRNLSIFPDNYFELEEVARLKVLAAAKGNIQADWFTDEMTKS
TLESVAAIKTIQQENGELGANRYIISNNENAHNVYETLALFQLTGWEQPTVDIIPLFETV
EDLHVADTVMEQLYQNESYMEHLARRGMKQTIMLGFSDGTKDGGYLMANWGIYQAKESLT
AMSRKYGIKVIFFDGRGGPPARGGGKTHKFYASLGPNIENEEIQITIQGQTISSNFGTRD
TCRYNLENLLSAGISNEIFSKGENMLSTSEVETMDRLAKYAYDEYLAFKKHPKFIPYLER
RSALKYYSMANIGSRPAKRSKSATLDFNDLRAIPFVGAWSQLKQNVPGFFGLGGALKSFE
DSQEWDKVQDLYNNSMFFKTLIENSMMSLAKSFFALTAYMKDDPEFGEFWQIIHTEYLET
ERLLLKLAGFETLMENYPDSKASIKVRENIVLPLLTIQQYALLKISELNEEENQDEAMIA
VYEKIVTRSLFGNINASRNSA
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atgtatacccccacgaaaatggaacgttttaataataacgttcttttaaaataccagctt
ttcaatagtatttttatcacacttccttttgattctattgataatacaggtgcccttctt
ccccttttttccgaatgctgtgaagccggctttaaaaaaggagattctcccaaagatatt
gtaaacggtttttccgaacgttacctggaaaatgccagcgaacagcagaagattgatata
atgtttcgctttatacagtatgtagagcggcaggtcgtcctttttgacgccattgaggat
gcttcatttgccgttgtccataatcttgaaggaacaggttccctgcgtaatattaaggag
aaagcggaatccaacaataagatgggtaaactgcgggaagtgctggatgattttaagatc
cgtacggtccttaccgcacacccgacacaattctatcccgggtctgtattggggatcatt
accgatcttactgcagcgataaaacaaaatgacctgaacagtattcggcagcttttagcg
cagctgggaaaaacaccttttatcaaaaaagaaaagccgacaccttttgacgaagcagtt
agcctgacctggtacctggaaaatgtattctattattccattggggaaatccttcaatat
tttcaaaagaatatcttgggcggagaactgaaagacaatgcaattgtcaacctgggattc
tggcctggaggcgatcgggatggaaatcctttcgttacaactgatattactctcaaagtg
gcagcacggctgagatcctccatattaaagtgttattacaaagatatccgtgctttaaaa
cgaaagctaacattctcaaaaatagatgctatagtattggatgttgaacaaaagctttac
cgttcggtattctattctgatggtgagatattcattaccgtagcagagtttaaagcgaaa
ttaaaagagatacgggtgttgctgatcaatgagaagcaatccctatatatcgacgacatc
aatgaccttattaataaggtggatgttttcggattctattttgccacactcgatattcgc
cagaatagtaaaatccacgatggcgttttcaaaaatattgttgcagaaacacaaaaaagg
aacctgtctatttttccggataattattttgaactggaggaagtagcacgactgaaagtt
ttggctgcagcaaaaggaaacatacaggcagactggtttacggatgagatgacaaaatca
actttggaatctgtagcggcaattaaaacaatacagcaggagaatggggaactgggcgct
aaccgttatatcatcagtaataatgaaaatgcccataatgtctatgaaaccttagcgttg
tttcaactgaccggatgggaacagccgacagtagatattattcctttatttgaaaccgtg
gaagaccttcatgttgctgatacggtaatggagcagttgtaccagaatgaatcgtatatg
gaacatttggctcgaaggggcatgaagcaaaccatcatgcttggtttttctgacggaacc
aaagacggaggctacctgatggctaactggggaatttaccaggctaaggaatccctgacg
gccatgtcacgcaaatatggcatcaaagtcatattctttgatggccgtggtggcccaccg
gcacgtggtggcggtaaaacccataaattctatgcttcactgggacctaatatcgaaaat
gaagaaatccagattactatccagggacagacgataagttccaattttggtacccgcgat
acctgccgttacaatcttgagaatctcttaagtgccggaatctccaatgagattttcagc
aaaggtgaaaatatgctttctaccagtgaggtggagaccatggacaggctcgcaaaatat
gcctatgatgaatacctggcttttaaaaaacatcctaagttcattccgtatttggagcgt
agaagtgctttaaaatattattccatggccaatatcggtagccgccctgccaaaaggagt
aaatcggcaacgcttgattttaatgacctgagggcgattccttttgtaggagcctggagc
cagctgaaacaaaatgttcctggattctttggactgggtggtgcactaaaatcatttgaa
gacagccaggaatgggataaagtccaggatttatacaataactccatgttttttaagacc
ctgatcgaaaatagtatgatgtcccttgctaaatccttttttgcattgacagcgtacatg
aaagacgatccggagtttggggaattctggcagattattcacaccgaatatttggaaacc
gaacggcttttgcttaaacttgcaggctttgaaacgctgatggaaaattatccggacagt
aaagcctcaattaaagtgagggaaaatatcgtactgccactattgactatccagcaatat
gcattactgaaaattagtgaacttaacgaagaggaaaatcaggatgaagcaatgatcgct
gtttatgagaaaatcgtaacacgctccttatttggaaacatcaatgccagcaggaattcc
gcttaa

DBGET integrated database retrieval system