KEGG   Flavisolibacter tropicus: SY85_00700Help
Entry
SY85_00700        CDS       T04392                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
fla  Flavisolibacter tropicus
Pathway
fla00620  Pyruvate metabolism
fla00680  Methane metabolism
fla01100  Metabolic pathways
fla01120  Microbial metabolism in diverse environments
fla01200  Carbon metabolism
Module
fla_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:fla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SY85_00700
  09102 Energy metabolism
   00680 Methane metabolism
    SY85_00700
Enzymes [BR:fla01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SY85_00700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ANE49241
UniProt: A0A172TQA0
LinkDB All DBs
Position
185111..187681
Genome map
AA seq 856 aa AA seqDB search
MDYPSSRALENFKRQVGLKFQLYNSLFTALPFHRIEKTGVLLALFLNNCEEGYENKQSPT
EIVTDFFNRFTSYAGGKEQIDLLFRFVQYVERQVVLFDALEDAAFNEVNDLVGAGTLKQL
ISKVVQVNNRQTLIARLKNFSVSLVLTAHPTQFYPGSVLGIINDLAKALKDNKTDQVNLY
LQQLGKTPLFKHEKPTPYDEAVSLIWYLENVFYKAIGRILAELKMEIAGLNLLESQVVKL
GFWPGGDRDGNPNVTVDTSLKVADALRTSIIKCYYQDVRRLRHRLTFKGVESILADLESK
LYHHLFIPGSDITLSQQEILQSLQQIRNILVKEHNSLFLFLLDDLINKVEVFGLHFASLD
IRQESSVHNTVLEEIAAKENLLPRDYATLNEKEKIELLTSIEGRADISLYEGLTKDTLQS
FEVIKAIQATNGPLGCYRYIISQCTSALNVLEVYGLFLCNGWKKEELSADIIPLFETIDD
LKRAPQVMRDLYENQAYRQHLQRRKNIQTIMVGFSDGTKDGGYLMANWSIYKAKNELSLV
SKEYGIEVIFFDGRGGPPARGGGKTHKYYAAMGQQISSKEIQLTIQGQTISSNFGNVDAA
QYNIEQLLDAGVTNVLFADSKMQMLPEQEEVIIELADISYQAYNQLKQHPQFFDYLAEIS
PLNYFSDTNISSRPSKRGKTSGLTLKDLRAIPFVGAWSQIKQNVPGYFGVGTALQTLDDK
GKLEDIKHLYKQSLYFKTLLDNCEMVMKKSYFSLTAYLAGNPVYSNIYDIIWREYELTKK
YILLVTERPELMSDYPVEQLSIQMREKIVLPLTTIQQFALTKLREDKEMPAEERSVLERL
VVRTSFGIINAGRNSV
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atggattacccttccagtagagctttggaaaactttaagcgccaggtgggccttaagttt
cagctgtataatagcttgtttaccgccttgccttttcatcggatagagaaaacgggcgta
ttgttagccttgtttttaaataactgtgaggaagggtatgaaaataaacaaagcccaact
gaaattgttactgatttttttaatcgctttacatcctacgccggtggaaaggagcagatc
gatttattatttcgctttgtgcagtatgtagaacgccaggtagtattatttgatgcttta
gaagatgcagccttcaatgaagtaaacgatcttgtaggtgccggtaccttaaaacaatta
ataagcaaggtggtgcaggttaataaccgtcagacactgatagcccggttgaaaaacttc
tctgtatcattggtacttacggcacatcctacccagttttatcccggttcagtactggga
atcattaatgacctggctaaagcgcttaaagacaataaaacggaccaggtaaatctatac
ttgcagcaattagggaaaacacccctgtttaaacatgaaaagcctactccgtatgatgaa
gccgttagcttgatctggtatcttgaaaacgttttttacaaggccattggccgcatttta
gcggagctgaagatggagattgcaggattaaacctcttggagagccaggttgttaaactg
ggcttctggccaggtggtgacagagatggaaaccctaatgtaacagtagatacctcatta
aaagtggctgatgccttgcggaccagcattatcaagtgttattaccaggatgtaagaaga
ctgcggcatcgcctcacctttaaaggcgttgaatccatactggccgatttagaatccaag
ttgtaccatcacttgtttattcccggtagcgacattacactttcccaacaagagatattg
cagtcattacagcagattcgtaacatattggttaaggaacacaatagcttatttctcttt
ttgttagatgatctgatcaataaagtagaggtatttgggttgcactttgcttcgctggat
atacggcaggagagttcagtgcataataccgttctggaagaaatagcagcaaaggaaaac
ctgctgccacgtgattatgcaacgttgaatgagaaagaaaagatcgaattacttacatca
atagaaggccgcgcagatatatcattgtatgagggccttactaaagataccttacagtca
tttgaagtaataaaggccatacaggccactaatggcccactaggctgttaccgctatatc
attagtcagtgtacgagtgctttaaatgtgttggaggtgtatggtttgttcttatgtaat
ggctggaaaaaagaagaactgtcagcagatatcatccccttgtttgagaccattgacgat
ttgaaaagggcgccacaggtaatgcgtgatctttatgagaatcaggcttaccggcagcac
ctacaacgtaggaaaaacatacaaactattatggtgggtttttcagacggtacaaaagat
ggcggctacctgatggccaactggagtatctataaagctaaaaacgagttgtcgctcgta
tctaaagaatatggtattgaggtcatcttctttgatggccggggcggacctccagccaga
gggggtggtaaaacacataaatattatgctgctatgggccaacagatctcctccaaagag
atccaattgaccattcaggggcaaaccattagctccaattttggcaatgttgatgctgct
cagtataacatagagcagttgttggatgccggagttaccaatgtcttgttcgcagacagt
aagatgcagatgcttccggagcaagaagaagtaataattgaactggccgatattagctac
caggcatataatcaactcaaacagcacccgcagttttttgactatttagcagagatcagt
ccactcaattatttcagtgacaccaatattagcagccgtccttctaaaagaggaaagacc
agcggccttaccttaaaagaccttcgtgccattccgtttgttggtgcctggagtcaaatc
aagcaaaacgttccgggttattttggagtaggaacagcgcttcaaaccttagatgataaa
gggaaattggaggatataaagcatttgtacaaacaatcgctttattttaaaacgcttttg
gataactgtgagatggtgatgaagaaaagttatttctctttaacggcttacctggctggt
aaccctgtgtacagcaatatttatgatatcatttggcgcgagtatgaactaacaaaaaaa
tacatcttgctggttacagagcggcctgagttaatgagtgattatccagtagagcaattg
tccatacaaatgagagaaaagatcgtgctgccgctaaccactattcagcagtttgcgctt
accaaactgagggaggataaagaaatgcctgcagaagaacgctctgttttggaacgctta
gtggtgcgcacatcttttggaatcatcaatgccggaaggaattcggtatag

DBGET integrated database retrieval system