KEGG   Flavisolibacter tropicus: SY85_04850Help
Entry
SY85_04850        CDS       T04392                                 

Definition
(GenBank) alpha-glucosidase
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
fla  Flavisolibacter tropicus
Pathway
fla00500  Starch and sucrose metabolism
fla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SY85_04850
Enzymes [BR:fla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     SY85_04850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C
Motif
Other DBs
NCBI-ProteinID: ANE49921
UniProt: A0A172TS69
LinkDB All DBs
Position
complement(1198474..1200609)
Genome map
AA seq 711 aa AA seqDB search
MRSVLLLICFFLCQLISAQQLQSPDKQLTLTFSLQDGGVPAYALTYKGKDVIRPSKLGLE
LKSDTSLTKGFRVQDTKTTSFDETWQPVWGEVRNIRNQYNELAVTLEQPSTQRSLVIRFR
LFNDGLGFRYEFPLQKNLGHFVIKEERTQFALSGDHKAFWIPGDYDTQEYSTVTSNLSEV
RGKMKAAITPNASQTPFSPTGVQTPLMLKSKDGLYINIHEAALVDYSCMHLELDDKNMIL
NSFLTPDAVGDKGTLQTPSKSPWRTIIVSDRAGDILESKLVLNLNEPTKYKNTSWIKPIK
YIGVWWEMITGKSTWSYTDLDNVKLGITDFTHAKPNGKHAANTQHVKEYIDFAAKHGFDA
VLVEGWNVGWEDWFGKHKDYVFDFVTPYPDFDVKELHRYAASKGVKIIMHHETSGAVRNY
ERHLDTAYKFMVENGYNAVKSGYVGDILPRGEYHYNQWMVNHYLYAIAKAAEYGIMVNAH
EAVRPTGLSRTYPNLIGNEAARGTEYEAFGGSNPDHTTILPFTRLIGGPMDYTPGIFETK
VSAYNPSNTSFVHTTLARQLALYVTMYSPLQMAADLPETYNKYLDAFQFIKDVAVDWDDS
KVLEAEPGDYITFARKAKGTNNWFIGSTCDENGRTSTINFNFLDPGKKYVATIYSDAKNA
HYETNPKAYTIRKAVVTNKSKLSQLCAPGGGYAISVMEATDATALKGLKTL
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagtgttttattattgatttgtttctttctgtgccaattgataagtgctcaacag
cttcaatcacctgataaacagttaacactaaccttttctttgcaggatggtggtgtgccc
gcttatgcacttacctataaaggaaaggatgtgattcgtcctagcaaattgggacttgag
ttaaagagcgatacatcactaaccaaaggcttccgtgttcaagacactaaaacaaccagt
tttgacgaaacctggcaaccggtatggggtgaagtgagaaacattcggaaccagtacaat
gaactggctgtgacgttggaacaaccctctactcaacgttccctggttatccgtttccgg
ctcttcaatgatggcttaggcttccggtatgagtttccgttacaaaagaacctaggtcat
tttgttattaaagaagaaagaactcagtttgcactctctggcgatcataaggcattttgg
attccgggtgattatgatacccaggagtatagcacagtaacatcaaacttgtcagaagta
cgtggcaaaatgaaagcggccattactccaaatgcttcgcaaacacctttttctccaaca
ggtgtacaaacgcctttgatgctaaaaagcaaggatggcttgtatatcaatatccacgaa
gccgccctggtagactactcttgtatgcacctggaattggatgataagaacatgattcta
aattccttccttacaccagatgcggtaggagataagggtactttgcaaacgcccagcaaa
tcgccttggcgtactatcatagtgagcgatagagctggtgatattttagagtctaaactg
gttctgaacctcaacgagcctacaaaatacaagaatacatcttggatcaaacccatcaag
tatattggtgtatggtgggaaatgattacaggtaaaagcacatggtcttataccgacctg
gataatgtcaaattaggtataacagactttacacatgcaaagcctaatggtaagcatgcc
gctaatacacagcatgtaaaagaatatattgattttgctgctaagcatggatttgatgct
gtgctagttgaaggctggaacgtaggttgggaagactggtttggtaaacacaaagattac
gtatttgactttgtaacgccctatcccgattttgatgtaaaagaactccaccgctatgca
gcttccaaaggtgtaaagatcatcatgcaccatgaaacctcaggtgctgtacgcaactat
gagcgccacttggatacagcctataagtttatggtagaaaacggttataacgcggtaaaa
agtggttatgttggtgatatcttaccaaggggagagtaccattataaccaatggatggta
aatcattacctgtatgctattgccaaagctgccgaatatggtattatggtaaatgcacat
gaagctgtgcgcccaacaggcttaagtcgtacctatcctaacttgatcggtaatgaagca
gctcgtggtacagaatatgaggcctttggtggcagtaatccggaccacacaaccattctg
cctttcacccgattaattggtggccctatggactatacacccggtatttttgaaactaag
gtgagtgcgtacaatccaagtaatacttcttttgtacataccaccttggcgcgtcagctg
gcattgtatgtaaccatgtacagcccgttacagatggcggccgacttaccagaaacttat
aataagtatttagatgccttccagttcattaaagacgtagcagtcgattgggatgatagt
aaagtattagaagcagaacccggcgattacatcacatttgcccgtaaagcaaaaggaact
aataactggtttatcggtagcacttgcgatgaaaatggacgcacctctacaataaacttc
aatttcttagatcccggtaagaaatatgtagctacgatttatagcgatgccaagaatgca
cattatgagactaatcctaaagcatacaccattcgaaaagcagttgttacaaataagagc
aaactatcccagctttgtgcaccgggtgggggatatgccataagtgtaatggaagccact
gatgctaccgccttaaaaggattgaaaacgctttaa

DBGET integrated database retrieval system