KEGG   Flavisolibacter tropicus: SY85_05730Help
Entry
SY85_05730        CDS       T04392                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
fla  Flavisolibacter tropicus
Pathway
fla00380  Tryptophan metabolism
fla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fla00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    SY85_05730
Enzymes [BR:fla01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     SY85_05730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ANE50070
UniProt: A0A172TSR3
LinkDB All DBs
Position
complement(1399176..1400453)
Genome map
AA seq 425 aa AA seqDB search
MKFLNTQDFAQQLDAADSLRSFRQQFLFPQHNGKDAIYFLGNSLGLQPKRTATDMAEVMQ
QWQELGVESWFKGDKPWLQYHDKLVGPLAAIVGALPGEIVVMNSLTVNLHLMLASFYQPK
GKRNKIICEAKAFPSDQYTLETHVKQRGFKPEDVIVEVAPREGEVNIRHEDVLAAIEANK
DELALIFWGGLNYYTGQVFNMKTITAAAHAVGAMVGFDLAHAAGNIQLQLHNWDVDFACW
CSYKYLNSGPGAIGGVYIHERFHNDKELPRFAGWWGYNKATRFKMQPGFDPIPSAEGWQL
STPSVLLYAAHYSSLQLFEKAGMSSLYQKGQQLSDYLLFLLQDLNANSSQPIVQVLTPKE
NKGCQVSMLMLRNGREVFDALTDAGVFADWREPNVIRIAAVPMYNTFEEVWQFAQIMKTT
CEQFQ
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttctaaacacacaagattttgcccagcagttagatgctgctgattctttacgt
tcgtttcgtcaacaatttcttttccctcagcataatggaaaagatgcgatttatttttta
ggtaactctttaggattacagccaaaacgtacggctacagatatggctgaagtaatgcag
caatggcaggaactaggcgtagaatcctggtttaaaggcgacaagccttggttgcaatac
cacgacaaattagttgggcctctggctgcaatagtaggtgcgttgcctggtgagatcgtt
gtgatgaacagccttacagtaaacctgcacctaatgctggcaagcttttaccagcccaag
ggaaagcggaacaaaatcatctgtgaagccaaagccttcccttcagatcaatatactttg
gagacacatgtaaagcaacgtggctttaaacccgaagacgtgattgtagaagtagcacca
agagaaggggaagtgaatattcgtcatgaagatgtattggctgcaattgaagctaataaa
gacgagttggcgctgatattctggggtgggttaaactattataccgggcaggtttttaat
atgaaaaccattacagctgccgctcatgcggttggcgctatggttggctttgacctggca
catgctgccggtaacatacaactgcaattacataactgggatgtggactttgcttgttgg
tgcagttataaatatttaaactcgggtccaggcgccattgggggcgtgtatatacatgag
cgttttcataatgataaagaactgcctcgctttgctggttggtggggttataataaagct
acacgttttaaaatgcagcctggctttgatccaattccctctgcagaaggttggcagcta
agtacgccttcggtattgctgtatgctgctcactattcttcattgcaattgttcgagaag
gcaggcatgtcttcattatatcaaaaaggacagcaactgagtgattatttattatttctt
ttgcaggatttgaatgcaaacagcagtcagccaattgtacaagtgcttacgccaaaagag
aacaaaggctgtcaggtgtcgatgttgatgttgcgtaacggtcgtgaagtttttgatgct
ttaaccgatgctggggtatttgccgattggagagaacccaatgtaattcgtattgccgca
gtaccgatgtacaatacctttgaagaagtttggcagtttgcccagatcatgaaaacaacg
tgtgaacaatttcaatga

DBGET integrated database retrieval system