KEGG   Flavisolibacter tropicus: SY85_06845Help
Entry
SY85_06845        CDS       T04392                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
fla  Flavisolibacter tropicus
Pathway
fla00240  Pyrimidine metabolism
fla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fla00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SY85_06845
Enzymes [BR:fla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SY85_06845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK Mu-like_Com Ribosomal_L37e
Motif
Other DBs
NCBI-ProteinID: ANE50257
UniProt: A0A172TU33
LinkDB All DBs
Position
1644653..1645231
Genome map
AA seq 192 aa AA seqDB search
MFIEPHIKGECGGWIEVICGSMFSGKTEELIRRLKRAKIANLKVEIFKPAIDIRYDEVKI
VSHDENQIHSTPIDNSQKILLLAQDVDVVGIDEAQFFDDQLPYVCDELACRGVRVIVAGL
DMDYLAKPFGQMPALLAKADYITKLHAICMRCGNIANYSYRKIPNEDRIMLGEKDVYEPR
CRRCYTLGSALD
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtttattgaacctcacataaaaggagaatgcggcggatggatagaagtcatttgcggc
tctatgttttcaggcaaaacagaagagttgatacgtcgcctaaaaagagcaaagattgct
aacctaaaggttgaaatcttcaaaccggctattgatatacggtatgatgaagtaaagatt
gtttcgcacgatgaaaatcaaatccattctacccccattgacaactctcagaagatctta
ttgttagcgcaagatgtagatgtagtaggaattgatgaagcccagttctttgatgatcaa
ctcccctacgtttgcgatgaattagcctgtagaggggtgcgtgttatcgtcgctggatta
gacatggactatctggccaagccatttgggcaaatgcctgccctactagctaaagctgat
tatattacaaagctgcacgctatctgtatgcgttgtggcaatatcgctaattattcgtat
cgcaaaatacccaacgaagaccgtatcatgctgggtgaaaaagatgtttacgaacctcgc
tgccgccgctgctacaccttaggtagcgctcttgattaa

DBGET integrated database retrieval system