KEGG   Flavisolibacter tropicus: SY85_08700Help
Entry
SY85_08700        CDS       T04392                                 

Definition
(GenBank) pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
fla  Flavisolibacter tropicus
Pathway
fla00010  Glycolysis / Gluconeogenesis
fla00020  Citrate cycle (TCA cycle)
fla00620  Pyruvate metabolism
fla01100  Metabolic pathways
fla01110  Biosynthesis of secondary metabolites
fla01120  Microbial metabolism in diverse environments
fla01130  Biosynthesis of antibiotics
fla01200  Carbon metabolism
Module
fla_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SY85_08700
   00020 Citrate cycle (TCA cycle)
    SY85_08700
   00620 Pyruvate metabolism
    SY85_08700
Enzymes [BR:fla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SY85_08700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 PYNP_C GCV_H HlyD_3 DUF2118 Monooxygenase_B
Motif
Other DBs
NCBI-ProteinID: ANE50569
UniProt: A0A172TTZ8
LinkDB All DBs
Position
2077420..2079066
Genome map
AA seq 548 aa AA seqDB search
MAEVILMPRLSDTMTEGVIAAWHKKVGDSVKKGDLLAEIETDKATMELESYKDGTLLHTG
ADKGGKLQVNDLLAIIGNPGEDISQYLSGGGQQAPQQQTEQAPAQPQASQPAPAPQPSAA
PSMDLSKMEEVVLMPRLSDTMTEGVIANWHKKVGDTVKKGDLLADIETDKATMELESYKD
GKLLYQGAKPGEKIAVNDLLAIIGDESKVDVQSIVNAAKGGGQPQPQAQAPQQAQAQPQA
AAPQQAAAAPQPVASGDGRVKASPLAKKLAQEKGIDLSTVQGSGDNGRITKADIDNYKPQ
AAAPTAAAPSAQPALQPIVSGQEGFSDTNVSQMRKVIAKRLGESKFSAPHFYLTMEINMD
NAMEARTQMNEVSAVKISFNDMVVKASAMALRKHPAVNSSWMGDFIRQYQHIHVGVAVAI
EDGLIVPVVRFADQKSLSQIAAETKELAGKAKNKKLQPNEFTGNTFTISNLGMMDIDEFT
AIINPPDSAIMAVGRIKEVVVRKGDGFGVSNVMKVTLSCDHRSVDGAVGASFLQTFKKYM
ENPVTMLV
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagtgatattgatgccgcgcctgagtgatacaatgaccgaaggcgtcatcgcg
gcttggcataagaaagtaggtgatagtgtaaagaaaggtgacctactggctgaaattgag
accgacaaagctaccatggagctggaaagctacaaagatggtacgctcttacatacaggc
gcagacaagggaggcaaactgcaggttaatgacctgctggccatcataggcaatcctggt
gaagacatttctcagtacctttctggcggtggccaacaggctcctcagcagcaaactgaa
caggcaccagctcaacctcaggccagccagcctgcaccagcccctcagccatcagcagct
ccttctatggatctaagcaaaatggaagaggtagtgttgatgcctcgcttaagcgatacc
atgacagaaggcgtaattgctaactggcataaaaaagtaggcgatactgtgaaaaaaggc
gacttactagccgacatcgaaaccgataaggctacgatggagctggaaagctataaagat
ggtaaactgctttaccaaggagctaaaccaggtgagaagatagccgtaaatgatctactt
gccattattggtgatgaaagtaaggtagatgttcaatctattgtaaatgctgctaaaggt
ggtggtcagccacaaccacaggcacaagcccctcaacaagctcaagctcagcctcaagcg
gccgctcctcagcaggctgctgcagcgcctcaaccagtggcttctggtgatggccgtgta
aaagcgtctcctttagctaagaaactagcacaagaaaaaggtattgatctgtctactgta
caaggttctggcgacaacggccgtattacaaaagcagatatcgacaactataaaccacaa
gcagcggctcctacagctgcagcgccttcagcacaaccggctcttcagccaattgtatct
ggacaggaaggcttctctgacactaacgtttcgcaaatgcgtaaggttattgctaagcgc
cttggtgaaagcaagtttagtgctccacacttctacctgactatggagatcaacatggat
aacgccatggaagcccgtacacagatgaatgaagtaagtgcagtgaagatctcctttaat
gatatggttgttaaagcttcagccatggctttacgcaaacatcctgctgttaattcttcc
tggatgggcgactttatccgtcaatatcaacacatccacgttggagtagcagttgctatt
gaagatggcttgatcgtaccggttgtacgttttgctgatcaaaaatcattaagccagatt
gcagctgaaactaaagagctggcaggtaaggctaagaataaaaaattacaaccaaacgaa
ttcacaggtaacacattcaccatttcaaacttgggaatgatggacattgatgaatttaca
gctattatcaacccaccagacagcgctattatggctgtaggtcgtattaaagaagtagta
gtacgcaaaggtgatgggtttggcgtaagtaatgtgatgaaagtaaccttaagctgcgac
caccgtagtgtagatggcgctgtaggagcttcgttcttgcagaccttcaagaagtacatg
gagaatccagtaacgatgctggtgtaa

DBGET integrated database retrieval system