KEGG   Flavisolibacter tropicus: SY85_09220Help
Entry
SY85_09220        CDS       T04392                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
fla  Flavisolibacter tropicus
Pathway
fla03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:fla00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    SY85_09220
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:fla03400]
    SY85_09220
Enzymes [BR:fla01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SY85_09220
DNA repair and recombination proteins [BR:fla03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     SY85_09220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ANE50657
UniProt: A0A172TV90
LinkDB All DBs
Position
complement(2224090..2226813)
Genome map
AA seq 907 aa AA seqDB search
MGLSLYNKKRNFSQTPEPSGKTKTSKSTLRFVIQKHDASSLHYDFRLEMDGVLKSWAIPK
GPSLNPADKRLAMMVEDHPYDYRNFEGVIPEGNYGAGTVIVWDEGYYTPVAGEQLSRKEQ
EQILLKELEMGSLKFILYGKKLNGVYTLRRMRKGEEKAWLLIKSKDEYATDDDVTAQEAS
VKSGKTLADIAAKKGVKLNHPKEQNATQQKGAKKAITAVKTAAGAKKISLTKRAGVLSPL
LKSYKDLIQAQPMPANIKPAFATLVDEPFSDPQWLYEIKWDGYRALAYLNNTKVKLISRN
NKPFTDKYAPVTAALKELGINAVFDGEIVAIDKNGLANFQLLQNWQNAPVQLQFYVFDIL
WLNGYDLTRLPLIERKKILCELIPPKDLILRYSDHVIGNGSAFYKAALKQGLEGIMAKRA
DSIYEAGKRTADWLKIKVNKRQEVVIAGFTVPRKTRKFFGALLLGVYEDDEFVYVGHTGS
GFNTKSLKEIYDRLQPLVTNKSPFKKVPKTNMPATWVKPQLVCEIKFTEWTKEHIARHPI
FMGLRTDKKAKDVRVEKEEKRSTIVKKAAGKKETKTPVKRTTKKKSSLSKNSKKISGLQL
QLENGANQTVTINKIDLSLTNLDKIYWPNEGFQKIDSINHYLRMAPYILPFLLDRPHSLN
RHPNGIGAPNFFQKDMKGKQPQWLETYTDYSESTKTNVEYLVCTNEASLIYMANLGCIEM
NPWHSRVNSWQYPDWCLIDLDPEGVSFNTVIEVAQVIKKILDASGAKGYCKTSGATGMHI
YIPLGAKYDFDQSKQLAELICKLVQQEMPNSTSMERSPAKRKEKVYLDFLQNKETQTAAA
PYSIRPRQGASVSTPLHWDEVKKGLAPTDYTIKNIYERVKAEGDLFKPVLGRGINLEKVI
QQLITIL
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atgggcctttctttatacaataaaaagcgcaatttttcacagacgccagagccttctgga
aagacaaaaacttcaaagtctacgttacgctttgtgatacaaaagcacgacgcttctagc
ctgcattacgatttccgcttagagatggatggggtgctaaaaagctgggctattcccaaa
ggaccttcattgaaccctgctgataaacggttagcaatgatggtagaagatcatccatat
gactatagaaatttcgaaggcgtaatccctgaaggaaattatggtgctggtactgtaatc
gtgtgggatgagggatattatacaccagtggccggcgagcagctaagtaggaaagagcag
gagcaaattctgttgaaggagctagagatgggtagcctgaaattcattctttatggaaag
aaattgaacggtgtgtacacgttgagaaggatgagaaaaggagaggagaaggcttggtta
ttaataaagagtaaagacgaatatgctactgatgatgatgttacagcgcaagaggcttcg
gtgaagtcaggaaaaacattggccgatatagcagcgaaaaaaggcgtaaaactgaatcac
cccaaagaacaaaatgccactcaacagaagggggcaaagaaagctattactgcggtgaag
acagctgccggtgcaaagaagataagcctaacgaagagagctggggtactatctccacta
ttaaaatcgtataaagatctcattcaggcacaaccaatgcctgctaatataaaacctgca
tttgctactttggtggatgaaccttttagtgatccccaatggctatatgaaatcaaatgg
gacggttatagagctttagcgtatttgaataatactaaagtgaagttaatctcaagaaat
aataagccttttaccgataagtatgcgccggtaacagcggcattgaaagaattagggata
aacgctgtgtttgatggagagatcgtggctattgataaaaatggattagcaaactttcag
cttttacaaaactggcaaaatgcgccggtgcaattgcagttttatgtattcgatattctc
tggctcaatggatatgatcttacgcggctgcctttaatagaacgtaaaaagatcttgtgc
gagttaatacctccaaaagatttgattttgcgctatagcgatcatgtaattgggaatgga
agtgctttttataaagcggctttgaaacaaggattagaagggataatggctaagcgcgcc
gatagtatttatgaagcaggaaaacgtacagctgattggttgaagattaaagtgaataaa
agacaagaggtcgtaattgcaggatttacagtgccacgcaaaacccgtaagttctttgga
gccttactgcttggtgtatacgaagatgatgaattcgtgtatgtaggccatacaggcagc
ggttttaataccaaaagcctgaaagagatctatgaccgcttacagcccttggtaacgaat
aaaagcccatttaaaaaagtgcctaagactaatatgcctgccacttgggtaaaaccgcaa
ttggtttgtgagatcaagtttactgagtggaccaaagaacatattgcccggcatcccatt
tttatgggactgcgtacagataagaaggctaaagatgtccgtgtagaaaaagaagaaaag
cgaagcactatagtaaaaaaagcggctggaaaaaaggaaaccaagacacctgttaaaagg
acgactaaaaagaagtcttctttatctaaaaattctaagaaaatatctggcttgcaatta
cagcttgagaatggcgctaaccaaacagtaacaataaataaaatagacttatcattaacc
aatttagataagatctattggccaaatgaaggttttcaaaagatcgactcaattaatcat
tacctgcgaatggcgccatatatcttgccttttttgctagaccggccccactcgttaaat
cgtcatcctaacggtattggggctccgaatttctttcaaaaagatatgaaaggtaagcag
cctcaatggttggaaacctatacagactatagcgagtctactaagactaatgtagaatac
ctggtatgtacaaacgaagcgtcgctgatctatatggctaatttgggctgtattgaaatg
aatccttggcattccagagttaatagctggcagtatccagattggtgtctcattgacctg
gatcctgaaggcgtaagttttaatacggtaattgaagtggcacaggtaattaagaagatt
ctggatgcaagtggcgcaaaaggctattgtaaaacatcgggcgccacaggtatgcatatt
tatattccattgggcgcaaagtatgattttgaccaaagcaagcagttggcagaattgatc
tgtaaattagtgcaacaggagatgcccaatagtaccagcatggagcgcagtcctgctaag
cgcaaagaaaaagtgtatctggattttctgcaaaataaggaaacgcaaacagctgctgcc
ccatactctatccgtcctaggcagggggcttctgtttctacccccttacattgggatgaa
gtaaaaaaaggacttgcacctactgactatactatcaaaaatatttatgaaagggtgaag
gctgaaggtgatttatttaagccagttttaggaagaggtattaacttggaaaaagtgatc
cagcaattgattacgattctgtaa

DBGET integrated database retrieval system