KEGG   Flaviflexus sp. H23T48: EJ997_05740Help
Entry
EJ997_05740       CDS       T05772                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
flh  Flaviflexus sp. H23T48
Pathway
flh00010  Glycolysis / Gluconeogenesis
flh00030  Pentose phosphate pathway
flh00051  Fructose and mannose metabolism
flh00052  Galactose metabolism
flh00680  Methane metabolism
flh01100  Metabolic pathways
flh01110  Biosynthesis of secondary metabolites
flh01120  Microbial metabolism in diverse environments
flh01130  Biosynthesis of antibiotics
flh01200  Carbon metabolism
flh01230  Biosynthesis of amino acids
flh03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:flh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EJ997_05740
   00030 Pentose phosphate pathway
    EJ997_05740
   00051 Fructose and mannose metabolism
    EJ997_05740
   00052 Galactose metabolism
    EJ997_05740
  09102 Energy metabolism
   00680 Methane metabolism
    EJ997_05740
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    EJ997_05740
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:flh01009]
    EJ997_05740
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:flh03019]
    EJ997_05740
Enzymes [BR:flh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EJ997_05740
Protein phosphatases and associated proteins [BR:flh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     EJ997_05740
Messenger RNA biogenesis [BR:flh03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     EJ997_05740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AZQ76909
LinkDB All DBs
Position
1277758..1280007
Genome map
AA seq 749 aa AA seqDB search
MEPVKIAVLTSGGDAQGMNAIVRSVIRTALHVGAKPFAVREGWKGAVEGGDLIQEMSWSD
VSDILHRGGTIIGTARSDRFREREGMRDAVKNFVTRGIDRLVSIGGDGTQTGTNELREEW
SSLLEELVDRGEITREQADAHPKLYIAGVVGSIDNDLVGTDMTVGADSALHRIIDAIDAI
SSTAESHRRSFIIEVMGRHCGYLALMSAIAGGCDYVFVPEHPPADGWEDDMSRVLKEGRD
AGRRDSIIIVAEGAMDRHGEKITSERVKNALEERLGEAARVTMLGHVQRGGMPSAYDRWM
PTLLGYTATLELINSDGDAYIIGTRRNRLVKLPLMKAVQDTRAVKTYTAEGDYEAAIGAR
GTSYGEMVKTFDVLSAPVPPNGHAKPKGRIALVHVGGLAPGMNTAARTAVRLGIDRGYEM
VGIKGGLPGLVDGKLVPLSWWDVESWSSTGGAALGTRRRIPSIDEFYAMGRTIEDAKIDG
IMIIGGLNGFEAALKMKEERQRFSAFKIPIICVPASIDNNLPLTELSIGTDTALNTNVRV
LNQIKQSASASRRCFVTETMGRNSGYLALMSAIASGAEQVYLAETGITLAQLADDTAKMV
EAFERGRSLYLVVRNEYASEHYTTDFLTRVFEEEGAGLFDVRQSVIGHQQQGGNPSPFDR
LLAVRLVNKAISALDGYLSEGKDDCTYVGMTEGEIKVHRLSHMEEHWDPETRLPRDQWWL
GLKDVAYIVSDPNFDKPAQVLPILSTNIG
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atggaaccagtgaagattgccgtcttaacctcgggtggcgacgcccagggaatgaatgcc
attgtccgctccgtgattcgcacagccctgcacgtcggcgctaaaccgttcgcggtgcgg
gaaggctggaagggagccgttgagggcggcgatctgatccaggaaatgtcctggtcggat
gtttccgatattctccaccggggcggcacgatcatcggcacggctcgttcggatcgtttc
cgcgagcgcgagggcatgagggacgcggtgaagaacttcgtgacccgcggtatcgaccgt
cttgtctcaatcggtggtgacggaacccagacgggcacaaacgagttgcgggaggagtgg
tcgtcgctgctcgaggagctcgttgatcgtggtgagatcactcgggagcaggccgatgct
catccgaagctttacattgccggcgttgttggctcgattgataacgatctggtgggaact
gacatgacggtcggtgccgactcggcactgcaccgcatcatcgacgcgattgacgcgatc
tcttccaccgccgaatctcaccgccggtctttcatcattgaggtcatgggcaggcactgc
ggctacctggctctcatgagcgccattgccggcggctgtgactacgtctttgttcccgaa
catcccccggccgatggctgggaggatgacatgagccgggtcctcaaggagggccgcgac
gcgggccgccgcgactccatcatcattgttgccgagggcgcgatggaccggcacggtgag
aagatcacatcggagcgcgtgaagaacgctcttgaggagcggctcggtgaggccgcccgg
gtcacgatgctcggtcacgtgcagcgcggtggcatgccgtccgcctacgacaggtggatg
ccgaccctgctcggttacacggcaaccctggagctcatcaactccgacggggatgcctac
attattggcactcgccgcaatcgcctggtcaagcttcctctcatgaaggctgtgcaggat
actcgtgcggttaagacctacacggcagaaggcgactatgaggccgcaatcggtgcccgc
ggcacctcctacggcgagatggtcaagaccttcgatgttctttccgctccggttccgccg
aacggtcacgcgaagcccaagggccggattgctctggtccacgtgggtgggctcgcaccg
ggcatgaatactgcggctcgtacagccgtgcgtcttggtattgatcgtggctacgagatg
gtgggcatcaagggcggtttgccgggcctggttgacggcaagctggttcccctgtcctgg
tgggacgtggagtcctggtccagcacgggcggtgccgctcttggcacccgccgccgcatc
ccgtccattgacgagttctacgcgatggggcggaccatcgaggacgcgaagatcgacggc
atcatgatcattggcgggctcaacggcttcgaggccgcgctgaagatgaaggaggaacgc
cagcgtttttcggcgttcaagatcccgatcatctgcgtgcctgcctcgatcgataacaat
ctgccgctcaccgaactgtcaattggaaccgatacggcgctgaacacgaacgttcgggtt
ctcaatcagatcaaacagtccgcctccgcttcccgccgctgcttcgtcacggaaacaatg
ggccgcaacagcggctacctggctctcatgagcgccattgcctccggtgcagaacaggtg
tacctggcagaaacggggataaccctggcacagctggccgacgatactgcaaaaatggtc
gaggcatttgagaggggccggagcctctacctggttgtgcgaaacgaatatgcttccgag
cattacacgacggacttcctcacccgcgtattcgaggaggagggtgccggactattcgat
gtccgccagtccgtgatcggccaccagcagcagggaggtaacccctcccccttcgaccgg
ctcctcgccgtccgcctcgttaacaaggcgatcagcgcgctcgacggttacctatcggag
ggtaaggatgactgcacctatgtcggcatgaccgagggcgagatcaaggtccaccggctc
tcgcacatggaagagcactgggatccggaaacgcgcctgccgcgtgaccagtggtggctt
ggcctcaaggacgttgcctacatcgtgtccgacccgaacttcgacaagcccgcccaggtt
ctcccgatcctttcaacgaacatcggctaa

DBGET integrated database retrieval system