KEGG   Bernardetia litoralis: Fleli_1522Help
Entry
Fleli_1522        CDS       T02149                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
fli  Bernardetia litoralis
Pathway
fli00473  D-Alanine metabolism
fli01100  Metabolic pathways
fli01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:fli00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Fleli_1522
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Fleli_1522
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:fli01011]
    Fleli_1522
Enzymes [BR:fli01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Fleli_1522
Peptidoglycan biosynthesis and degradation proteins [BR:fli01011]
 Precursor biosynthesis
  Racemase
   Fleli_1522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AFM03944
UniProt: I4AJ09
LinkDB All DBs
Position
complement(1813947..1816502)
Genome map
AA seq 851 aa AA seqDB search
MSISSLITRANYITDYYKEFRYKQLLTDSRKLAIPHDTIFFAIKGQRHDGHNFIKKLYDK
GVRYFIIEDEEAALRNFKNAQEAEGAQLLLVKNSIRALQELAAHHRKQFKLPVIGITGSN
GKTIIKEWLSELLADSFQIIKSPKSYNSQIGVPLSVWELSEEHTLAIFEAGISQPHEMEY
LEPIIQPNIGIFTNLGSAHDEGFKDRLEKATEKAKLFENCKYLISRDIYSAVNTAILHLK
ERKGDPHFFGWTTQDVSIYPSAVDMRYLDPNVGGVNVGLYDPHTNQKLNFYLPFSNPAHV
ENCLHCIVTMLLFEYKEKEIQEKINKLKAVEMRLELKQGIFNCSLIDDTYNNDFGGLQVA
LDFLLQQSNKPKRTVILSDMPEENQKGLYEKIFQLCAKKGVGRVIAIGENIKRTLLPDTE
TLIDVKFFTTTEDFLGDFADGDIRFGNEAILIKGARKFEFEKIVEALELKVHGTKLEINL
NSLAHNLDYFRSLISPRTRIMAMVKAFGYGSGSNFEIAHLLQYHRVDYLAVAYVDEGIAL
RNEGIRTPIMVMNPSIDSFEKMYVHKLEPEIYSVATLKRYVEYAKEKAYHLNLAEFGADI
KDVFKIHLKLDTGMNRLGFATSDLPILLSLIKAVGESLEVASVFTHLAAADDNQMDDFSS
QQIKEFEEWAAELEQQLGYSFLRHAVNSAGIIRFKNAHFEMVRLGLGLYGIDSSKKAQEY
LLPISSLKATISQIKVVHPNESIGYSRKGKVERISKIATIAIGYADGYDRRFGNGVGKVY
LHGELAPTIGNICMDMCMVDVTEIEDAKEGDEVIIFGEYPTVTDLANTIGTIPYEILTNV
SERVKRIFYAD
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atgtctatttcttcgcttattactcgtgccaattacattacagattattacaaagagttt
cgttacaaacaacttttgactgatagtcgtaaacttgccattcctcatgatactatattt
tttgctataaaaggacaacgtcatgatggacataattttatcaaaaaactctatgataaa
ggagtacgatattttataattgaagatgaagaagcagctttaaggaattttaaaaatgca
caagaagcagaaggcgcacaacttttacttgttaaaaatagtattcgtgccttacaagaa
ttggcagctcatcacagaaaacaatttaaacttcctgttattggaattacgggcagcaat
ggaaaaacgattattaaagagtggttatcagagcttttggctgatagttttcagattatc
aaaagtcctaaaagttataactctcaaattggagttcctttgtctgtttgggagctttca
gaagaacatacattagccatttttgaagctggaatttcgcagcctcatgaaatggaatat
ttagaacctattatacagccaaatattggaattttcacaaacttaggaagcgcacacgat
gaaggttttaaagatagattagaaaaagcaaccgaaaaagccaagctctttgaaaactgt
aaatatttgatttcaagagatatttattcagcagtcaatacagcaattcttcatttgaaa
gaacgaaaaggagaccctcatttttttggttggacaactcaagatgtctctatttatcct
tctgctgttgatatgcgctatcttgacccaaatgttggaggtgtaaatgttgggctttat
gacccacacacaaatcaaaaactcaacttttatttacctttttctaatcctgctcacgta
gaaaattgtttgcattgtatagttacgatgcttctctttgaatataaagaaaaagaaatt
caagaaaaaataaataagctaaaagcagtagaaatgcgccttgaactcaaacaaggaatt
tttaattgtagcttgattgatgatacctataataatgattttggaggtttacaagtggct
ttagattttttattacagcaaagtaacaaacccaaaagaacagttattttgtcggatatg
ccagaagaaaatcaaaaaggattgtatgaaaaaatatttcaactttgtgcaaaaaaaggc
gtagggcgtgttattgctattggtgaaaatataaaaagaacacttttgcctgacaccgaa
acgcttattgatgtcaaattttttacaacaacagaagattttttaggtgattttgcagat
ggagatattcgttttggaaatgaagcaattttgataaaaggagctagaaaatttgagttt
gaaaaaattgtggaagccttagaactcaaagtacatggaacaaaactagaaattaatctt
aatagtttagctcataatttggattattttcgttcgttgatttctcccagaactagaatt
atggcaatggtaaaagcatttgggtatggcagtggttcaaactttgagattgctcatctt
ttacaatatcatagagtagattatttggctgtggcgtatgtagatgaaggaattgcgcta
agaaatgaaggaatcagaacaccaattatggtaatgaatccatcaatagatagttttgaa
aaaatgtatgttcataaacttgaacctgaaatttatagtgttgctacactaaaaagatat
gtagaatatgccaaagaaaaagcctatcatttgaatttggctgaatttggtgcagatata
aaagatgtcttcaaaatccatttaaaattagatacaggaatgaatcgtttgggttttgct
acaagtgatttgcctattttattgagtttgattaaagctgttggagagtcgttggaagtt
gcaagtgtttttacacatttggctgctgctgatgacaaccaaatggatgacttttcatca
caacaaataaaagaatttgaagaatgggctgctgaattggagcaacaattagggtattct
tttctgcgtcatgctgttaattcagcaggaattattcgcttcaaaaatgctcattttgag
atggttcgtctaggattaggattgtatggaattgattcttccaaaaaagcacaagaatat
ttattaccaattagctcgcttaaagcaactatttcacaaataaaagtagttcatccaaat
gaaagtattggttattcaagaaaaggaaaagtagaacgcatctcaaaaattgcaactatt
gccattggttatgctgatggatatgatagacgttttgggaatggagtaggaaaagtatat
ttgcatggcgagcttgcaccaacgattggaaatatttgtatggatatgtgtatggttgat
gtaaccgaaattgaagatgctaaagaaggcgatgaagttattatttttggagaatatcca
accgttaccgaccttgcgaacacaataggaacaattccgtatgaaatcttgacaaatgta
agcgaacgtgtgaagcgtattttttatgccgactaa

DBGET integrated database retrieval system