KEGG   Bernardetia litoralis: Fleli_3192Help
Entry
Fleli_3192        CDS       T02149                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
fli  Bernardetia litoralis
Brite
KEGG Orthology (KO) [BR:fli00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fli01001]
    Fleli_3192
Enzymes [BR:fli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Fleli_3192
Protein kinases [BR:fli01001]
 Serine/threonine kinases: Other
  Bacterial family
   Fleli_3192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TPR_12 TPR_10 TPR_2 TPR_19 DUF2225 APH TPR_8 Kdo Bro-N Pkinase_fungal DDE_1 Mob_Pre
Motif
Other DBs
NCBI-ProteinID: AFM05524
UniProt: I4ANI9
LinkDB All DBs
Position
complement(3805515..3808166)
Genome map
AA seq 883 aa AA seqDB search
MNANRWQLIQDIFSEALELEGQERENYILSKTKEDTELKQEVENLLQSSEKANSFFGNLE
GKVSTAWQKATETTLLSEGEKVGIYQIEKEIGRGGMAVVYLAKRIDGEFEQKVAIKVIKR
GMDSDEVLRRFMAEKQILASLNHPNISKILNSGLAPNGLPYFVMEYVEGMDLIEYCDKNN
LSIKERLEIFIQICRTLQYAHRNLVIHRDLKPSNILIENNQKDTTKNTHNSLKLLDFGIA
KVLDEDNDLRTKTAMRLLTPEYASPEQIQGKIISTSSDIYQLGILLFELLSGRRPFVFDK
NESVLEWEKKLTTSQTPTPSKIYEEFSENQAQKVAKERKTDKKGLKKTLKSELQSIVLMA
LRTEPERRYQSAEQLAEDIERYLQKRPIIAKPNSWSYKTRKAFERNKSAWIGFTLLFIAL
IGGIFGTTYQAYKTKQEKQRAEQTLAFITDLFKSPDPRLQDSEGKDIKVSEFLKASEKKV
FRNLEDQQELQTELLTILSNLYDNMNLAKEGTELEEKLLPKFIKQYGRNSPRVAESIRKI
AAWSFETNKDVEKTDSIFQEAFDIFEKTYTKEHNKYAVLLNEYGLFLQISRADLEKAESI
LQQAGEIFVKNDTITANYGNNLSFRGLVANQMGRLDEALSLYERELFIKQKVNQDSVGLA
LVKINMASVYFKQQNLIRAETINKEALKIMEAELGMQHKHTLTALNNLAAVYAAQDRHDL
GKPIALRAYNGFVNKYGEKNDRTAASALNVGFYYTKLKEFDSALVYINQANETYKQLFGE
THYVTGVPLLARAEIWLGKNEPQKAFQDAQKADELLATPPIPTIHYYRGMVNFRLGSCYI
ALNDKEKGKKYLQKSVDILMQTNGKTHYATKAAMKQLAVISNQ
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaaaccgttggcaactcattcaagatattttttcagaagccttagaattagaa
ggacaagaacgagaaaactatattttgtctaaaacaaaagaagacacagagctaaaacaa
gaagttgaaaacctcttacaatcatctgaaaaagcaaatagtttttttggaaacttagaa
ggtaaagtttcgactgcatggcaaaaagcaaccgaaacaacactactttcagaaggcgaa
aaagtaggtatttatcaaatcgaaaaagaaattggacgaggaggaatggctgttgtttat
ttggcaaaacgaattgatggagaatttgagcaaaaagtagctattaaagttatcaaacgt
ggaatggattctgatgaggttttgaggcgttttatggctgaaaaacaaattttggcttct
ctaaatcacccaaatatttccaaaatattgaatagtggacttgcgccaaatggacttcct
tattttgtgatggaatatgtagaaggaatggatttgatagaatattgtgataaaaataat
ctttctataaaagaacgtttagaaatttttattcagatttgtaggactttacaatacgct
cacagaaatttggttattcatagagatttgaaaccttcaaatattctaatagaaaataat
caaaaagatactacaaagaatacacataattcattaaaactattagattttggaattgca
aaagttttggatgaagacaatgacttgagaaccaaaacggctatgcgacttttgactccc
gaatatgcaagtccagaacaaatacaaggaaaaataataagtacttcaagcgatatttat
caattaggaattttacttttcgaattattgagtggaagaagaccatttgtttttgataaa
aatgaatctgttttggaatgggaaaagaaattaacaacttctcaaactccaacaccctct
aagatttatgaagagttttctgaaaatcaagctcaaaaagtagctaaagaaagaaaaaca
gataaaaaaggacttaaaaaaacattaaaatctgagttgcaatcgattgttttgatggca
cttcgcaccgaaccagaaagacgttatcaatcagccgaacagttggcagaagatattgag
cgttacttacaaaaacgtcctattattgcaaaacctaattcttggagttacaaaactcgt
aaggcattcgaacgaaataaatcagcttggataggttttacattgcttttcattgcgctt
attggtggaatttttggaacaacttatcaagcctacaaaacaaaacaagaaaaacaaaga
gcagaacaaacactagcttttattactgatttgtttaaaagtccagacccaagattacag
gattcggaaggaaaagatataaaagtaagtgagtttttaaaggcaagtgagaaaaaagta
tttcgaaatttagaagaccagcaagaactacaaactgaactccttactattttatctaat
ttgtatgataatatgaatttggcaaaagaaggaacagaactagaagaaaaattattacca
aaatttatcaaacaatatggtagaaactcgccacgagtagctgaaagtatcagaaaaata
gctgcatggtcttttgaaacaaataaagatgtagaaaaaacagattctatatttcaagaa
gcctttgatatttttgaaaaaacctatacaaaagaacataataaatatgctgttttatta
aatgaatatggtttatttcttcaaatatcaagagcagatttagaaaaagcagaatctatt
ttgcaacaagcaggagaaatttttgtaaaaaatgatacgattacagccaattatggtaat
aatttatcgtttcgtggtttggttgccaatcaaatgggaagactagatgaggcactttct
ttgtatgaacgagaattatttatcaagcaaaaagtaaatcaagattcggtcggattagca
cttgtaaaaataaatatggcttctgtttatttcaagcagcaaaacctcattcgtgccgaa
accataaataaagaagctctcaaaattatggaggcagaattaggaatgcaacacaaacat
acacttactgcgcttaataatttggcagccgtttatgcagctcaagaccgtcatgatttg
ggaaaaccgattgcgctgcgtgcttataatggttttgtcaataaatatggagaaaaaaat
gatagaacagcagcatcagcattgaatgtaggtttttattataccaaattaaaagagttc
gattcggctttggtgtatataaatcaagcaaatgaaacttataaacagctttttggagaa
acgcattatgttacaggtgttccacttttagctagggcagaaatttggttaggtaaaaat
gaacctcaaaaagcgtttcaagatgctcaaaaagcagatgaattacttgctacgcctccc
attccaacaattcattattatagaggaatggtcaattttcgtttaggaagttgttatata
gccttaaatgataaagaaaaaggtaaaaaatatctccaaaaatctgtcgatattttgatg
caaacaaacggaaaaacgcactacgcaaccaaagcagcaatgaaacaattagcagtaatc
agtaatcagtaa

DBGET integrated database retrieval system