KEGG   Flammeovirga sp. L12M1: EI427_02840Help
Entry
EI427_02840       CDS       T05771                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
fll  Flammeovirga sp. L12M1
Pathway
fll00250  Alanine, aspartate and glutamate metabolism
fll00410  beta-Alanine metabolism
fll00430  Taurine and hypotaurine metabolism
fll00650  Butanoate metabolism
fll01100  Metabolic pathways
fll01110  Biosynthesis of secondary metabolites
fll01120  Microbial metabolism in diverse environments
fll02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:fll00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    EI427_02840
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EI427_02840
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EI427_02840
   00430 Taurine and hypotaurine metabolism
    EI427_02840
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    EI427_02840
Enzymes [BR:fll01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     EI427_02840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AZQ61193
UniProt: A0A3Q9FLW6
LinkDB All DBs
Position
1:697309..698685
Genome map
AA seq 458 aa AA seqDB search
MITKKKITDPNAKHNNIRSIRNKVSVPKYELPQSEMDANEAYNIIHNELMLDGNARLNLA
TFVTTWMEPEAEKLMAETFDKNMIDKDEYPQTAMLEERCINIISRLFNAPEEEDTTGSSA
IGSSEAVMLAGMAFKRKWRDRQKAAGKSTENPNLVLGTNVQVVWEKFCRYWDVEPRFIPM
KEGKYVITADEVVAAIDENTIGVVAILGTTFTGEFEPIESIHDAMVKNNAAKGFVTPLHI
DAASGGFVAPFIHPDLKWDFRLPLVKSINVSGHKYGLVYPGVGWVVWRDKSELPEDLIFH
VNYLGGDMPTFTLNFSRPGNQIVGQYYNFIRLGRDGYTQVMTELRDIAMRLSSGIEKLGH
FELLSDGSSIPVFAFSVLPGANFTVYDMSSRLRERGWLVPAYTMPAEIEDKAVLRIVIRE
GFNSDMGEMLLEDIKNAADMFTSKGYREKRTSGSSFAH
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgattactaaaaagaaaataaccgacccgaacgcaaaacataataatattcgctcaatt
agaaataaagtgagtgttccaaaatacgagcttcctcaaagtgaaatggacgccaatgaa
gcgtataatattatacataatgaattaatgttagatggtaatgcacgtttaaatctagcg
acttttgttaccacttggatggagccagaagctgagaaactaatggcagagacattcgat
aaaaatatgatagataaagatgaatatcctcaaacagcaatgttagaagagaggtgtatc
aatatcatatcaagattatttaatgcacccgaagaagaagatacaacaggttcttctgct
ataggatctagtgaagctgtaatgctagctggtatggcgtttaaaagaaaatggagagat
cgtcaaaaagctgcagggaaatctacagaaaatccaaacttagttcttggtactaatgtt
caagttgtttgggagaaattctgtagatattgggatgttgaaccaagattcattccaatg
aaagaaggtaaatatgtaattactgctgatgaagtagtagctgcaattgacgaaaataca
ataggagttgtcgcaattttaggaacaacatttacaggcgaatttgaacctattgagtcg
atccatgacgcaatggttaaaaataatgcagccaaaggatttgtaactcctttacatata
gatgcagcaagtggaggttttgtagctccatttatacaccctgatttaaaatgggatttt
agattaccattagtgaaatcgatcaatgtttctgggcataaatatggtctagtttaccct
ggtgtaggttgggttgtgtggagagataaatctgaactaccagaagatttgatttttcat
gtaaattatttaggtggtgatatgccaacttttacattgaatttctctagaccgggtaat
caaattgttggacagtactataattttatacgtttaggccgtgatggatatacccaagtg
atgacggaattacgtgatattgctatgcgattatctagtggaatagaaaaacttggtcac
tttgaattattgagtgatggaagttcaattcccgtttttgcatttagcgtattgcctggg
gctaattttactgtgtatgatatgtcgagtaggctaagagaaagaggttggttagttcct
gcctatactatgcctgcagaaattgaagataaagcagtacttagaattgtaataagagag
ggctttaatagtgatatgggagaaatgctcttagaagatattaagaatgctgcagatatg
tttacgtctaaaggatatagagaaaaacgtacatcaggtagtagctttgcgcactaa

DBGET integrated database retrieval system