KEGG   Flammeovirga sp. L12M1: EI427_06115Help
Entry
EI427_06115       CDS       T05771                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase/oxidase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
fll  Flammeovirga sp. L12M1
Pathway
fll00564  Glycerophospholipid metabolism
fll01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fll00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    EI427_06115
Enzymes [BR:fll01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     EI427_06115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like GIDA Thi4 NAD_binding_8 Pyr_redox_2 FAD_binding_3 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AZQ61825
UniProt: A0A3Q9FPV6
LinkDB All DBs
Position
1:1522031..1523584
Genome map
AA seq 517 aa AA seqDB search
MNRKKMLSQVEATTLFDVIVIGGGASGLGTALDSTLRGYKTLLLEKDDFAKGTSSRSTKL
AHGGVRYLKQGDVGMVREALRERGLMKENAPHLVHDQKFIVPVYDWWDAPLYTTGLKVYD
VMAGSLGLGKSEMISKEKTLKHIPNLSQDGLIGGVRYYDGQFDDARLAITLAQTISDFEG
NLLNYAEVVGLEKDELDKVDGVRFIDSETGTEHVVKGTTVVNATGVFVDQILSMDDKNHK
PVVSPSQGVHIILDKEFLKGASSIMVPRTSDGRVLFAVPWYDKIVVGTTDTPLDSIDAEP
RALEEEIEFILKTAGQYLQKAPKRSDVRSVFAGLRPLVKKQEVETKNISRSHKILVNKSS
LITIVGGKWTTYRQMAEDAVDTIEKVAHIPSVKCITKDLLLHGYQQGADRLDVKSVYGND
LPKIEALITEAPKLGVEIHSDLPYRFADVYWGVKNEMARTVEDVLARRTRSLLLNACASI
EAAPEVAKMMAGILGKDEVWVDNQIEEYTTLAKGYMC
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaaaaaagatgttatcgcaagtagaagcaacaacgttgtttgatgtgatagtt
atcggcggaggagcttctggattaggaactgctcttgatagtactttaagagggtacaaa
acattattattagagaaagatgattttgcaaaaggtacttcaagcagaagtacaaagctt
gctcatggcggagtgcgttatttaaagcaaggtgatgttggtatggtgagagaagcattg
cgtgaacgtgggttgatgaaagaaaatgcacctcatttagtgcatgaccaaaagtttatt
gttcctgtttatgattggtgggatgcacctttatatactacaggattaaaagtatatgat
gtaatggctggaagtctaggtttgggtaaatcagaaatgatctcaaaagaaaagacttta
aaacatattccaaaccttagtcaagatggtttaattggaggagtaagatattatgacggt
cagtttgatgatgctcgattggcgataacattagcacaaactatctcagattttgaaggc
aatcttcttaattatgctgaggtagttgggttagaaaaagatgaacttgataaagttgat
ggcgtacgttttattgatagtgaaacaggtactgagcatgttgttaaaggaactactgta
gtaaatgcaacaggcgtttttgtagatcagattttaagtatggacgataaaaaccataaa
cctgtagtttcgccaagtcaaggagtacatattattttagataaagagtttttaaaagga
gcttcgtctataatggtacctagaactagtgatggtagagtattgtttgctgttccctgg
tacgataaaattgtagttggaacaacagatacaccgctagattctatagatgctgaacca
agagcattagaagaagaaattgagtttattctaaaaacagcagggcaatatttacaaaaa
gcacctaaaagatctgatgtaagaagtgtctttgcaggtttgcgacctttagtaaagaaa
caagaagttgagacaaaaaatatttctcgatcacataagattctcgttaataagtcaagt
ttaattacgatagtaggtggtaaatggacaacttatagacagatggcagaggatgctgtt
gatacaatcgagaaagtagctcatattccatcagtaaagtgtattacaaaagatttacta
ttacatgggtaccaacagggagcagaccgtttagatgtaaaaagtgtttatggaaatgat
ttaccaaaaatagaagcattaattacagaagcacctaagttaggagttgagatccattcc
gatttaccttaccgatttgcagatgtttattggggagtgaaaaatgaaatggcaagaacg
gtagaagatgttttagcaaggcgtacaagaagtttacttttaaatgcgtgtgcaagtatt
gaagctgctcctgaagttgctaaaatgatggcagggatattaggaaaagatgaagtttgg
gttgataatcaaattgaagaatataccaccttggcaaaaggatatatgtgctag

DBGET integrated database retrieval system