KEGG   Flammeovirga sp. L12M1: EI427_12295Help
Entry
EI427_12295       CDS       T05771                                 

Definition
(GenBank) biotin/lipoyl-binding protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
fll  Flammeovirga sp. L12M1
Pathway
fll00010  Glycolysis / Gluconeogenesis
fll00020  Citrate cycle (TCA cycle)
fll00620  Pyruvate metabolism
fll01100  Metabolic pathways
fll01110  Biosynthesis of secondary metabolites
fll01120  Microbial metabolism in diverse environments
fll01130  Biosynthesis of antibiotics
fll01200  Carbon metabolism
Module
fll_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fll00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EI427_12295
   00020 Citrate cycle (TCA cycle)
    EI427_12295
   00620 Pyruvate metabolism
    EI427_12295
Enzymes [BR:fll01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     EI427_12295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118 HlyD_3 Peptidase_M23 ATP-synt_ab_Xtn RnfC_N Het-C GSK-3_bind
Motif
Other DBs
NCBI-ProteinID: AZQ62992
UniProt: A0A3S9P4H8
LinkDB All DBs
Position
1:3080926..3082584
Genome map
AA seq 552 aa AA seqDB search
MAEIIRMPKMSDTMTEGVIASWLVKVGDQIASGDVIAEVETDKATMELENYEDGTLLYIA
VQEKEAVAIDGIIAIVGEEGEDYQSLLSGDTAAAPAEAPAAPAAPEAPAAAPAPAAEAID
TSGINATVVKMPKMSDTMTDGTISSWLMKVGDEVNAGDILAEVQTDKATMELESYDEGKL
LYVAVEDGGSVPVDGVIAIIGEEGADYETLLKAEAAKSAAPTTEAAPVAEAAPAPKAAAA
APVAKKTSAPAVAQSRDAAPAPEHDGKRVFASPLAKKMAEDKGFNIAMIPGSGDHGRVIK
RDVEAFVPAPTTAPATPPVAAVPAGVESFDDQPMNNMRKAITRNLNSSQFGAPHFYLTMD
IDMDNAMAARKSMNEVADVKISFNDMVVKAVAASLKKHPMVNSLVEGDVIRVASHVNVGV
AVAIPDGLVVPVIRHTDSLSLSQISGTVKEMAGKAKDKKLSLDEMTGATFTISNLGMFGI
EQFTSILNAPASCILAVGGIKQVPVVKNGQIVPGNVMKITLTCDHRSVDGAIGAAFLHTL
KGLLEDPVRILI
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaataatcagaatgcctaagatgtctgatacgatgacagaaggcgttatcgca
tcttggctagtaaaagtaggtgatcaaatagcatctggagatgtgatcgctgaggttgaa
acagataaagcaacaatggaacttgagaactatgaagatggtactttattgtacatcgca
gttcaagagaaagaagctgttgctatcgatggaattattgcaattgttggagaagaaggt
gaagattaccaatcacttctttctggagatactgctgctgctcctgcagaagctcctgcg
gcacctgccgctccggaagctcctgctgctgctccagcacctgctgcagaagcaatagat
acttctggtatcaatgcaactgtagttaaaatgccaaaaatgtcagatacaatgactgat
ggtactatttcatcttggttgatgaaagttggtgacgaagtaaatgctggtgatatttta
gctgaagttcaaacggacaaagctacaatggaattagaatcttacgatgaaggtaaactt
ctatacgttgctgttgaagatggtggttctgttcctgtagatggtgttattgccattatt
ggtgaagaaggcgctgattacgaaactttattaaaagctgaagcggcaaaatctgctgct
cctactactgaagctgctccagttgctgaggctgctcctgcacccaaagccgccgctgct
gctccagttgctaagaaaacttctgcacctgctgtagctcaatcaagagatgcggctcct
gctccagagcatgatggaaaaagagtatttgcttctccattagctaagaaaatggctgaa
gacaaaggttttaatattgctatgattcctggatctggagatcacggtagagtaattaag
cgtgatgttgaagcattcgttcctgcaccaacaactgctcctgctactcctcctgtagct
gctgtgcctgctggtgttgaaagctttgatgatcagcctatgaataatatgcgtaaggcg
atcactagaaaccttaactctagccaatttggtgctcctcacttctatttaacaatggat
atcgacatggacaatgctatggcagcaagaaagtctatgaacgaggttgcagatgttaaa
atttctttcaatgatatggttgttaaagctgttgctgcttctttaaagaagcatccaatg
gttaactcattagttgaaggtgatgttattagagtagcaagccatgtaaatgtaggtgta
gctgttgctattcctgatggtttagtagtaccagtaattagacatacagattcattatct
ttatctcaaatttctggaactgttaaagagatggctggtaaagcaaaagataaaaaatta
tctttagatgaaatgacaggtgcaacatttacaatttcaaacttaggtatgtttggaatt
gaacagttcacttcgattttaaatgctcctgcttcttgtattttagctgttggtggtatt
aagcaagttcctgttgttaaaaacggtcaaattgttcctggtaacgtaatgaaaattaca
cttacttgtgatcatagatctgttgatggtgcaatcggtgctgcattcttacatacactt
aaaggtcttttagaagatcctgttagaatcttaatctaa

DBGET integrated database retrieval system