KEGG   Flammeovirga pectinis: EI427_18100Help
Entry
EI427_18100       CDS       T05771                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
fll  Flammeovirga pectinis
Brite
KEGG Orthology (KO) [BR:fll00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EI427_18100 (ahpF)
Enzymes [BR:fll01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EI427_18100 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like GIDA Thioredoxin_3 FAD_binding_2 DAO Thi4 NAD_binding_7 FAD_oxidored NAD_binding_8 AlaDh_PNT_C FAD_binding_3 FMO-like Lycopene_cycl Thioredoxin_4 K_oxygenase Glutaredoxin Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: AZQ64071
UniProt: A0A3Q9FPA8
LinkDB All DBs
Position
1:4585188..4586765
Genome map
AA seq 525 aa AA seqDB search
MLEQALKEQVRGLFGYLKSKFTFNVIVAADHKSKSDLLSLLEDVVATTDKITLNVAEGEG
LSFSIVKEDVDSGIVFRAVPTGHEFTSLLMAVLNMDGIGKNLPDEMLTKRIKNISGKVEL
KSYISLTCTNCPEVVQALNVMAIYNPNIKHAIIDGGINKEEVEALGIQAVPTVTLNGKQL
HVGRSSLGELLGKIEEQLGTTFSLEDAEEKEYDVIVVGGGPAGVSSAIYSARKGFSVAII
AGTVGGQVKETVSIENMISISKTTGAELTANLNQHLKDYPIDVLENRMVEGVEIIDGVKH
VTTSLGEKFSTPALIIATGASWRKLGVPGETEYIGSGVAFCTHCDAPYFKGKKVVVVGGG
NSGLEAAIDLSSIAAEVTVLEFMDTLKGDQVLQDKVNSLSNVAVITNAKTLEVDGDGKQV
TGLKYENRENGNVETVVTDGVFVQIGLTANSGAFKEILDTNRMGEIEIDAHCRTKVAGVY
AAGDVSIVPYKQIVIAMGEGSKAALSAFEDKIKNKQLSNESTLAY
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgttagaacaagcattaaaagaacaagtacgaggattattcggttacctaaaaagcaaa
tttacatttaacgtaattgtagcggcagatcataaaagtaaaagcgatttactatcgtta
ttagaagatgtggtcgctactacagataaaattacattgaatgtggcagagggtgaaggg
ctatctttttcaatagtaaaagaagatgtagactcgggtattgtttttagagcagtgcca
accggacatgaatttacttcgttgttaatggctgtgttaaacatggatggtattggtaaa
aaccttccagatgaaatgttgacaaaacgtattaagaacatttctggtaaagtagaatta
aaaagttatatctcattaacgtgtactaattgtccagaagtagttcaggcattgaacgta
atggcaatatataaccctaacatcaaacacgctattattgatgggggtattaataaagaa
gaagtagaagcattgggtattcaagcagtaccaactgtaacgcttaatggtaaacaatta
cacgttggtagatcatctttgggtgagttacttggaaaaattgaagagcaattaggtaca
actttctctttagaagatgcagaagaaaaagaatacgatgtaattgttgttggaggtgga
cctgctggagtttcatcagcaatttattctgctagaaaagggttttctgtagccattata
gcaggtactgttggaggtcaggtaaaagaaactgtttctattgagaacatgatttctata
tcaaaaacaacaggcgcagaattaactgctaatttaaatcaacacttaaaagattatcca
attgatgtattggagaatagaatggtagaaggggttgaaattatagatggcgtaaagcat
gtaacaacttctttaggagagaaattctctacacctgcgttaattattgctacaggtgca
agttggagaaaacttggtgtacctggcgagacagaatatattggttctggtgttgccttt
tgtacacactgtgatgctccttattttaaaggtaaaaaagtggttgttgtaggtggaggt
aactctggtttagaagcagcaatcgatttatcttctattgccgctgaggtaactgtttta
gaatttatggatacacttaaaggagatcaagttttacaagataaagtaaatagcctttct
aatgtagctgtaattacaaatgcaaaaacgttagaggtagatggcgatggcaaacaagtt
actggcttgaaatacgaaaaccgtgagaatggtaatgtagaaacagttgtaacagatggt
gtatttgtacaaattggtttaactgcaaatagtggagcatttaaagaaattttggataca
aaccgtatgggtgaaatcgaaattgatgcacattgcagaacaaaagtagcaggtgtttat
gccgctggcgatgtatctattgtaccttacaaacaaattgtaattgcaatgggagaaggt
tctaaagctgctctttctgcttttgaagataagattaaaaataaacaactatctaatgag
tcaactttggcttattag

DBGET integrated database retrieval system