KEGG   Flammeovirga sp. L12M1: EI427_18440Help
Entry
EI427_18440       CDS       T05771                                 

Gene name
cobT
Definition
(GenBank) nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase
  KO
K00768  nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase [EC:2.4.2.21]
Organism
fll  Flammeovirga sp. L12M1
Pathway
fll00860  Porphyrin and chlorophyll metabolism
fll01100  Metabolic pathways
Module
fll_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:fll00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EI427_18440 (cobT)
Enzymes [BR:fll01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.21  nicotinate-nucleotide---dimethylbenzimidazole phosphoribosyltransferase
     EI427_18440 (cobT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DBI_PRT
Motif
Other DBs
NCBI-ProteinID: AZQ64130
UniProt: A0A3S9P7F0
LinkDB All DBs
Position
1:4664028..4665032
Genome map
AA seq 334 aa AA seqDB search
MSLTSDIQQKIDLKTKPIGALGELEELAKKICLVQNTTSPTLHKPTIIVFAADHGLAKEG
VSAYPQEVTFQMVHNFLNGGAAINVFAKQHNIQLKIVDAGVNHDFENATDLINAKVGKGT
QNMLHEPALSSGEIAMCFDKAKEIINSDAIKDADIIGFGEMGIGNTSSATLIMSALYKLR
LDECIGKGTGVDLEGFKKKYNILEQVKEKHGDITSAIGIISAFGGFEICMIAAAMLEAAS
LKKMIIVDGFIVTTAYALAKALNPDIQKNAIFSHVSDEKGHTLLLQKLDANPLLHLGMRL
GEGTGAAMAFPIIQSAVNFMNEMASFSSANVSNK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagcttgacttcagatattcaacagaaaatagatttaaaaacaaaaccaattggagca
ttaggagaactagaagaattagcaaagaaaatatgtctagttcaaaatacaacatctcca
acactacataagccaacaataattgtattcgcagcagaccatggtcttgcaaaagaagga
gtaagtgcttatccacaagaagtaactttccagatggtccataattttttaaatggagga
gctgcaataaatgtttttgcaaaacagcataatattcaattaaaaattgttgacgcaggt
gttaatcacgattttgaaaatgcgactgatttaattaatgctaaagttggtaaaggaact
caaaatatgcttcatgagcctgcattatcatcgggtgaaattgctatgtgttttgataaa
gctaaagagattattaatagtgatgctattaaagatgctgatattattggctttggagag
atgggtattggtaatacatcatcagctactttaataatgagtgctctttataagctaaga
ttagatgaatgtattggtaaaggtactggtgttgatcttgaaggatttaaaaagaaatat
aacatactcgaacaagtaaaagaaaagcatggtgatatcacttcagccataggtataata
agtgcttttggaggatttgaaatatgtatgattgcagctgcaatgttagaagctgcttct
cttaaaaagatgattatagttgatggatttatagtaacgacagcatatgctttagcaaag
gctttaaacccagatattcagaaaaacgcaatttttagtcatgtatctgatgaaaaagga
catacacttttacttcaaaaattagatgctaatccattattacatttgggaatgcgatta
ggcgaaggaactggagctgctatggcttttccaattatccaaagtgctgtaaattttatg
aatgaaatggctagcttttcatctgctaatgtgagtaataagtaa

DBGET integrated database retrieval system