KEGG   Flammeovirga sp. L12M1: EI427_25410Help
Entry
EI427_25410       CDS       T05771                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
Organism
fll  Flammeovirga sp. L12M1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C UDPG_MGDP_dh_N Pyr_redox_2 Pyr_redox YqaH
Motif
Other DBs
NCBI-ProteinID: AZQ65554
UniProt: A0A3S9PBH4
LinkDB All DBs
Position
2:complement(1363321..1364343)
Genome map
AA seq 340 aa AA seqDB search
MKAAFYESKGKFTVGKGEQIKPEAGEVRLDVAYCGVCGTDVHIFHGVMDQRVSPPQTVGH
EASAVVAEVGEGVTNVKVGDKVAVRPLHFGDEHPFDKGFKHVGKNLKFIGIDSSGAFQNS
WTVPSYTLHKLPEQVNLMHGAFIEPLSVACHDVKIGRVKAGENCLVIGGGPIGTLIGYVI
KEKGANVIISEVNETRLKMLDDLGFTTINPAKENLTERISDLTEEAMIDCAFEVSGSAPG
VQTMTEVVNVRGRIVMVAIHGGEQKKVDLFKFFWSEIELLGARLYEEDDYEEAIKIASSG
NVPFEDLITKVDDLENIQSVFDEIDKNPEGMKYLIKCNDN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcattctatgaatcgaaaggaaaatttactgttggtaaaggggaacaaatt
aaacctgaagctggtgaagtaagattagacgttgcgtactgtggagtatgtggtacagat
gtacacattttccatggtgtgatggatcagcgtgttagtcctccgcaaactgtagggcat
gaagcttctgcagttgttgccgaagttggagagggtgttacaaatgtaaaagtaggtgat
aaagtagctgttagacctttgcattttggagatgaacatccatttgataaaggatttaaa
catgtaggtaaaaacctaaagtttattggaatagattctagtggagcattccaaaatagt
tggactgtaccttcttacacactgcataaattaccagaacaagtaaacttaatgcatggt
gcttttatagagccattatctgttgcttgtcatgatgtaaaaattggtagagtaaaagca
ggtgaaaattgcttagtaattggtggtggaccaataggtacattaattggttatgtgata
aaggaaaaaggtgcgaatgtaatcatttcagaagtaaatgaaacaagattaaaaatgttg
gatgatttaggttttacaacaattaatcctgctaaagaaaatctaacagagcgtatttct
gacttaacagaagaagcgatgatcgactgtgcatttgaagtttctggttctgcacctggt
gtacaaactatgaccgaagtagtaaatgtaagaggtagaattgtgatggtagccatacat
ggaggcgaacaaaagaaagttgatttatttaagtttttctggtctgaaatagagttactt
ggagctcgtttatatgaggaagatgattatgaagaagcaattaaaattgcaagttctggt
aatgttcctttcgaagatctgattactaaagtagatgatttagagaatatacaatctgtt
tttgatgagattgataaaaatcctgaaggtatgaaatatcttattaagtgtaacgataat
taa

DBGET integrated database retrieval system