KEGG   Flammeovirga pectinis: EI427_25410
Entry
EI427_25410       CDS       T05771                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
fll  Flammeovirga pectinis
Pathway
fll00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:fll00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    EI427_25410
Enzymes [BR:fll01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     EI427_25410
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     EI427_25410
    1.1.1.-  
     EI427_25410
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C UDPG_MGDP_dh_N Pyr_redox_2 Pyr_redox YqaH
Other DBs
NCBI-ProteinID: AZQ65554
UniProt: A0A3S9PBH4
LinkDB
Position
2:complement(1363321..1364343)
AA seq 340 aa
MKAAFYESKGKFTVGKGEQIKPEAGEVRLDVAYCGVCGTDVHIFHGVMDQRVSPPQTVGH
EASAVVAEVGEGVTNVKVGDKVAVRPLHFGDEHPFDKGFKHVGKNLKFIGIDSSGAFQNS
WTVPSYTLHKLPEQVNLMHGAFIEPLSVACHDVKIGRVKAGENCLVIGGGPIGTLIGYVI
KEKGANVIISEVNETRLKMLDDLGFTTINPAKENLTERISDLTEEAMIDCAFEVSGSAPG
VQTMTEVVNVRGRIVMVAIHGGEQKKVDLFKFFWSEIELLGARLYEEDDYEEAIKIASSG
NVPFEDLITKVDDLENIQSVFDEIDKNPEGMKYLIKCNDN
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgaaagcagcattctatgaatcgaaaggaaaatttactgttggtaaaggggaacaaatt
aaacctgaagctggtgaagtaagattagacgttgcgtactgtggagtatgtggtacagat
gtacacattttccatggtgtgatggatcagcgtgttagtcctccgcaaactgtagggcat
gaagcttctgcagttgttgccgaagttggagagggtgttacaaatgtaaaagtaggtgat
aaagtagctgttagacctttgcattttggagatgaacatccatttgataaaggatttaaa
catgtaggtaaaaacctaaagtttattggaatagattctagtggagcattccaaaatagt
tggactgtaccttcttacacactgcataaattaccagaacaagtaaacttaatgcatggt
gcttttatagagccattatctgttgcttgtcatgatgtaaaaattggtagagtaaaagca
ggtgaaaattgcttagtaattggtggtggaccaataggtacattaattggttatgtgata
aaggaaaaaggtgcgaatgtaatcatttcagaagtaaatgaaacaagattaaaaatgttg
gatgatttaggttttacaacaattaatcctgctaaagaaaatctaacagagcgtatttct
gacttaacagaagaagcgatgatcgactgtgcatttgaagtttctggttctgcacctggt
gtacaaactatgaccgaagtagtaaatgtaagaggtagaattgtgatggtagccatacat
ggaggcgaacaaaagaaagttgatttatttaagtttttctggtctgaaatagagttactt
ggagctcgtttatatgaggaagatgattatgaagaagcaattaaaattgcaagttctggt
aatgttcctttcgaagatctgattactaaagtagatgatttagagaatatacaatctgtt
tttgatgagattgataaaaatcctgaaggtatgaaatatcttattaagtgtaacgataat
taa

DBGET integrated database retrieval system