KEGG   Flammeovirga sp. MY04: MY04_0148Help
Entry
MY04_0148         CDS       T04442                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
flm  Flammeovirga sp. MY04
Pathway
flm00010  Glycolysis / Gluconeogenesis
flm00020  Citrate cycle (TCA cycle)
flm00620  Pyruvate metabolism
flm01100  Metabolic pathways
flm01110  Biosynthesis of secondary metabolites
flm01120  Microbial metabolism in diverse environments
flm01130  Biosynthesis of antibiotics
flm01200  Carbon metabolism
Module
flm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:flm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MY04_0148
   00020 Citrate cycle (TCA cycle)
    MY04_0148
   00620 Pyruvate metabolism
    MY04_0148
Enzymes [BR:flm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MY04_0148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118 Peptidase_M23 HlyD_3
Motif
Other DBs
NCBI-ProteinID: ANQ47530
UniProt: A0A1B1FN19
LinkDB All DBs
Position
1:complement(192746..194422)
Genome map
AA seq 558 aa AA seqDB search
MAEVIRMPKMSDTMTEGVIASWLVKVGDEISSGDIIAEVETDKATMELENYEDGVLLYIA
VEEKQAVPVDGVIAIVGEEGEDYQSLLDGNTSAAPAESAPAPAAEEAPAPAAAPAAEAID
VSGINATVVKMPKMSDTMTDGTISQWLMKVGDEVNAGDILAEVQTDKATMELESYDEGKL
LYVAVEDGGSVPVDGVIAIIGEEGADYETLLKAEEQKSAAPAEAAPAPAPKAEAPAAKPA
AAPAPAPKAAPAAAPAVAQSREAAPAPEHDGKRVFASPLAKKMAEDRGFNIAMIPGSGEH
GRVIKRDVEAYVPSPTPVAAAAAPAAALPAGVESFDDQPMNSMRKAIARNLTSSQFGAPH
FYLTMDIDMDKAMAARKSMNEIAEAKISFNDMVVKAVATSLKMHPLVNSLVEGDVIKVAN
HINVGVAVAIPDGLVVPVIRNTDMLSLSQISSTVKDMAGKAKDKKLGLDEMSGATFTISN
LGMFGIEQFTSIINAPASCILAVGGIKQVPVVKNGQIVPGNIMKITLTCDHRSVDGAIGA
AFLKTLKGLMEDPVRILI
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtaatcagaatgcctaagatgtcagatacaatgacagaaggcgtgatcgca
tcttggttagtaaaagtaggagacgagatttcatcgggcgatatcatcgcagaagtggaa
acagataaagccactatggaacttgaaaactacgaggacggcgttttattatatatcgct
gttgaagaaaaacaggcagtccctgttgacggagttatcgcaattgttggtgaagaggga
gaagactatcaatctcttctagacggaaatacatccgctgcaccagctgaaagtgctcca
gcacctgctgctgaagaagcacctgcaccggctgcagctccagctgctgaagctattgat
gtatcaggcatcaatgcaacagtagtgaaaatgccgaaaatgtctgatacaatgactgac
ggtacaatctctcaatggttaatgaaagttggtgatgaagtgaacgcgggtgatatcctt
gctgaagttcaaactgataaagcgacaatggagcttgagtcttatgacgaaggtaaacta
ttgtacgttgctgttgaggacggtggttctgttcctgttgatggtgttatcgctatcatc
ggtgaagaaggtgcagactacgaaactttattaaaagctgaagagcaaaagtctgcagct
cctgctgaggcggctcctgctccagctccaaaagctgaagctccagcggctaaaccagct
gctgcccctgctcctgctccaaaagcagctcctgctgctgctcctgcagttgctcaatct
agagaagctgctcctgctccagaacacgacggtaaaagagtttttgcttctccattggct
aagaaaatggctgaggatagaggttttaacatcgcaatgatcccaggttcaggtgagcac
ggtagagtaatcaaaagagacgttgaggcgtacgttccttctccaactcctgttgctgcc
gctgctgctccagctgctgcacttcctgcaggtgttgaaagtttcgacgatcaaccgatg
aatagcatgcgtaaagcaattgctagaaatcttacatcaagtcaatttggtgctcctcac
ttctatttaacaatggatatcgacatggacaaggctatggctgctagaaagtctatgaac
gagattgctgaggcgaagatttcattcaacgatatggtagtgaaagctgttgctacttca
ttaaagatgcacccattggtgaactctttagtggaaggtgatgtaatcaaagttgctaat
catatcaacgtaggtgtggctgtggctattcctgacggtcttgttgttcctgtaatcaga
aacacagacatgttgtctttatcacaaatatcttctactgtaaaagatatggctggtaaa
gcaaaagacaaaaaacttggtttagacgaaatgtctggtgctacattcactatctcaaac
ttgggtatgtttggcatcgagcaattcacttctatcattaatgctcctgcatcttgtatc
ttagctgtaggtggtatcaaacaagtacctgttgtgaaaaacggtcagatcgtacctggt
aacatcatgaagattacgcttacatgtgaccacagatctgtagatggtgctattggtgca
gcattcttgaaaacgctgaaaggattaatggaagatccagttagaatcctaatctaa

DBGET integrated database retrieval system