KEGG   Flammeovirga sp. MY04: MY04_0950Help
Entry
MY04_0950         CDS       T04442                                 

Definition
(GenBank) FAD-dependent glycerol-3-phosphate dehydrogenase subunit
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
flm  Flammeovirga sp. MY04
Pathway
flm00564  Glycerophospholipid metabolism
flm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:flm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MY04_0950
Enzymes [BR:flm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     MY04_0950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 GIDA HI0933_like FAD_binding_3 Thi4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ANQ48332
UniProt: A0A1B1FQC5
LinkDB All DBs
Position
1:1187865..1189418
Genome map
AA seq 517 aa AA seqDB search
MKIRNEIIQKIKTTNEYDVVVIGGGATGLGTALDSTLRGYKTLLLEAYDFAKGTSSRSTK
LAHGGVRYLKQGDVSMVKEALRERGLMKENAPHLVHDQKFIVPVYDWWDAPVYTTGLKVY
DVMAGKLGLGPSEMISKEETLKMIPNLNEEGLIGGVRYYDGQFDDARLAITLMQTIIDFE
GDVINYAKVTGLLKEENILKGVEVEDQETGELIQVNAKNVINATGVFVDSILKMDNEDAL
PSVSPSQGVHIILDKEFLKGSSSIMVPRTDDGRVLFAVPWYDKIVVGTTDTPMEEVSIEP
VALEEEIEFILKTAKKYLHKEPKREDVKAVFAGLRPLMKSTDEDTKKISRSHKIVKSQSG
LITVVGGKWTTYRQMSEDVINFMERKNEDIGVKCITKDVLLHGYKKDVDRLDVRSVYGND
LPKIELLIKNDPSLNKYIHPDLPYRWAEVKWGVENELARTVDDILSRRTRSLLFDAKASL
EASSKVAEFMADLLGKDEAWIENQITSFKKLVDNYTC
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgaagataagaaatgagataatacaaaagataaagactacaaacgaatatgatgttgtt
gttataggaggtggtgcgacaggtctaggaacagcacttgattctacattgagaggctac
aaaacattactattagaagcttatgactttgcaaaaggaacatcgagcagaagtacaaaa
ctagcacatggaggagtgagataccttaaacaaggtgatgtaagcatggtgaaagaagcc
ttgagggaaagaggtttaatgaaagaaaatgctcctcatttagtgcatgatcagaaattt
attgttcctgtatatgactggtgggatgcacctgtttatactaccggactcaaagtgtac
gatgtaatggcgggtaaattaggtttaggaccttctgaaatgatatcaaaggaagaaacg
cttaaaatgattcccaatctgaacgaagaaggacttataggtggagttcgttattacgac
ggacaatttgatgatgcaagactagcgatcactttaatgcaaaccattattgattttgaa
ggtgatgttattaattatgccaaagtaactggtcttctaaaagaagaaaatatattgaaa
ggtgttgaagttgaagatcaagaaaccggggagttaattcaggtaaatgctaaaaacgta
attaatgcaacaggtgtttttgtcgactctattctaaaaatggataatgaagatgctttg
ccatccgtatcaccttctcagggagtacatattattttagataaagagttcttaaaaggg
agttcctccattatggttcctagaactgatgatggaagggtattatttgccgttccatgg
tacgataaaattgtagtaggaacaacagatactccaatggaggaggtgagtatagaacca
gtcgctttagaagaagaaattgagtttattttaaaaacagcaaaaaaatatcttcataag
gaaccaaaaagggaagatgtaaaagcagtttttgcaggtctaagacctttaatgaaatct
actgatgaggatacaaagaaaatctctcgttcgcataaaatagtaaaaagtcaatctgga
cttattactgtggttggtggtaaatggacaacttacagacaaatgtctgaggatgtaatc
aattttatggaaagaaagaacgaagacataggagtgaaatgcattacaaaagatgttcta
ttgcatggatacaaaaaagatgtggatagattagatgttaggagtgtctacggaaatgat
ttgcctaaaatagaattactgataaaaaatgatccttctttaaataaatatattcaccct
gatttaccttacagatgggctgaagtgaagtggggagtagaaaatgaattggcaaggaca
gtagatgatatcctttcaagaagaacgagaagtttattatttgatgcaaaagcaagtctt
gaagcatctagtaaagtagctgaatttatggctgatcttttaggaaaggacgaagcatgg
attgaaaatcaaattacctcctttaaaaaattagtagataattatacctgttag

DBGET integrated database retrieval system