KEGG   Flammeovirga sp. MY04: MY04_1957Help
Entry
MY04_1957         CDS       T04442                                 

Gene name
alr
Definition
(GenBank) Mur ligase domain protein/alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
flm  Flammeovirga sp. MY04
Pathway
flm00473  D-Alanine metabolism
flm01100  Metabolic pathways
flm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:flm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MY04_1957 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    MY04_1957 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:flm01011]
    MY04_1957 (alr)
Enzymes [BR:flm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     MY04_1957 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:flm01011]
 Precursor biosynthesis
  Racemase
   MY04_1957 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: ANQ49331
UniProt: A0A1B1FT49
LinkDB All DBs
Position
1:2445950..2448388
Genome map
AA seq 812 aa AA seqDB search
MSTNTSIDFSSSFWNAKYLLIDSRMLTAPSQTIFFALNGPKREGSEFIRELYDKGVRKFV
VTVDFDKGYLYKEATFVYVENTLQTLQEVTKYHRELFPDLPVIGITGSNAKTIIKEWLYT
LLEVDKNVVKSPKSYNSQIGVPLSVWQIDKKHELGIFEAGISKVDEMKNLQRIILPTIGL
FTNLGSAHDKLFDNRTQKLHEKGFLFDECQTIIYCRDHEDIHEELRQKKGELFHWGVHQE
AALRIEEIENQLVFLNFKGNKHQITIPFNDEASFENAMHCVAVLTYLGYSFKEINSRLSF
LKSLPMRLERKEGINGTVLINDFYNNDLGGLQIALSFMGQNQENLPKTLILSDLLQGHND
KTILYQKINELIHEHEIERFIGVGNHLSQHQNDITIDSQFFDNTSELKNAIRKQEITFNK
EMILLKGARQYEFEKIAALLQRKIHSTRLEINLDAVVHNLMFYKAQLQPSTKVMVMVKAL
GYGSGKHELAHTLQYHLVDYLGVAFADEGVELRENGIRTPIMVLTPSPDSFETMRRFQLE
PEIYNLEMLEALEDFLEEDENDTPFAIQINIDTGMHRLGFTAAELPILLEKLGKIASKVK
VTGVFTHLAGADEEQHNNYTLNQVKEFDKVAASIEDFLGYKVIKHCLNSAGIVRFPEHQM
DMVRLGIGLHGIEVNHIKQDDLQTVATLKSVIAQIKTIKKGETIGYGRKGVASKDMKIAT
IGIGYADGFNRHFSNGVGKMIINGKIAPVIGNVCMDMSMVDITDINAVVGDDVVIFGEDL
SITQLAKAIDTIPYEILTSVSSRVKRVYYMEG
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atgtctacaaacacaagtatcgatttttcttcttctttttggaacgcaaagtatctactt
attgatagtagaatgcttaccgctccatctcaaaccatcttttttgctttaaatgggcct
aaaagagaaggaagtgaatttatacgtgagttgtatgataaaggagtgagaaagtttgtg
gtcacggtagatttcgacaaaggttacctgtataaagaggcaacgtttgtctatgtggaa
aataccctacaaactttacaagaagttactaaataccatagagaactatttccagatctt
ccagtaattggtatcaccggatcgaatgctaaaacgatcattaaggaatggttgtacacg
ttattggaagtggataaaaatgtggtcaaaagtcctaagagttataactctcaaatcgga
gtacctttatcggtttggcaaattgataaaaagcacgaattaggcatttttgaggccggg
atttctaaggttgatgaaatgaaaaaccttcagcgaattattcttcctacgataggttta
tttaccaatttgggttctgctcacgataaattatttgataatagaacgcagaaacttcat
gaaaaaggttttctttttgatgagtgccaaaccatcatttattgtcgtgatcatgaagat
attcacgaggaacttcgacaaaaaaaaggggaattatttcattggggagtgcatcaagaa
gctgccttgaggattgaggaaattgaaaaccaattggtcttcctcaacttcaaagggaat
aagcatcaaataactattccatttaacgatgaggcttcattcgaaaatgccatgcactgt
gtggctgtgttgacttatcttggctattcatttaaggaaatcaacagtcgtttatccttc
cttaaaagtcttccgatgagattggagagaaaagaaggaataaatggcactgttctcatc
aacgatttttacaataacgatttaggaggtttgcagattgcgttaagctttatggggcaa
aatcaagaaaacttgcctaaaacgcttattctatccgatcttctgcaaggacataatgat
aaaacgattttgtatcaaaaaattaatgagttgatacatgagcatgaaattgaacgtttt
atcggggtgggaaatcacttaagtcaacatcaaaatgatatcacgattgatagtcagttt
ttcgataatacctctgagttaaagaatgcaataagaaagcaggaaatcactttcaataaa
gaaatgattcttttgaaaggagcacgtcaatatgaatttgaaaaaattgcggctctgctt
caaagaaagatacatagtactcgattagagatcaacttggatgctgtggtgcataatctc
atgttctataaagcacaacttcaaccttcaactaaagtgatggtgatggtgaaagcttta
ggttatggtagtggaaagcacgaattagcccatacgctacaatatcatttggtggattat
ttgggagttgcttttgctgatgaaggggtagaattaagagaaaatggtatccgtacacca
attatggtactaacaccttcgcccgattcttttgaaaccatgcgtcgttttcaactagaa
cctgagatctataacctagaaatgttggaagctttagaagactttctagaggaagacgaa
aatgatactccttttgctattcaaatcaatatagatacaggaatgcaccgacttggattt
acagccgctgaattgcctattttattagaaaaattaggaaaaatagcctcaaaagtaaaa
gtgactggtgtatttacacatttggctggtgccgatgaggaacagcacaataattatact
ttaaatcaagtaaaagaatttgataaagtggccgcttctattgaagattttcttggctat
aaagtgataaaacactgcttgaactctgctggaattgttcgctttcctgaacatcaaatg
gatatggtacgacttggaattggcctgcacggtattgaagtgaatcatatcaaacaggat
gatcttcagacggtggctactctaaaatctgtaattgctcagatcaaaaccatcaaaaag
ggagaaacgattggctatggacgaaaaggtgtcgcttcaaaagatatgaagattgctacg
attggtattggctatgccgatggctttaaccgacactttagcaatggggtgggtaaaatg
atcatcaatggaaagattgctcccgtcattggtaatgtgtgcatggacatgagcatggta
gatattaccgatatcaatgctgtagtgggtgatgatgttgttatttttggagaagatcta
agcatcacacaattggcaaaagcgattgatacgatcccatacgagatacttacttctgtt
agttctagagtgaagagggtctattatatggagggataa

DBGET integrated database retrieval system