KEGG   Flammeovirga sp. MY04: MY04_2497Help
Entry
MY04_2497         CDS       T04442                                 

Definition
(GenBank) Alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
flm  Flammeovirga sp. MY04
Brite
KEGG Orthology (KO) [BR:flm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MY04_2497
Enzymes [BR:flm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     MY04_2497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like Thioredoxin_3 FAD_binding_2 GIDA DAO Thi4 NAD_binding_8 NAD_binding_7 FAD_oxidored K_oxygenase FAD_binding_3 FMO-like Lycopene_cycl Thioredoxin_4 Cohesin Thioredoxin_9 Glutaredoxin AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ANQ49866
UniProt: A0A1B1FUK9
LinkDB All DBs
Position
1:complement(3111890..3113464)
Genome map
AA seq 524 aa AA seqDB search
MLEQALKTQVTTFFGHLKSQYTFEVTVADTHPSKNDMVSLMEDVASCSDKVTLNVQSGEG
LSMNIVKDGVPSNITFRAVPTGHEFTTLLLAVLNMEGIGKNLPDQAIINKIKSISEKVEI
SSYISLSCTNCPEVVQALNVMSMNNPNITHQIIDGGINQEEVEQLGIQAVPTVLVNGEQF
HVGRSSLGELLGKLEELVETSTENIEAIEKEYDVVVVGGGPAGVSSAVYSARKGFKVAVV
AGTIGGQVKETVGIENMISITKTTGAELTANLYNHLKDYPIDILENRWVENVEVVDGYKK
ITTSMNEVITAPALVIATGASWRKLGVPGETEYIGSGVAFCTHCDAPYFKGKKVVVVGGG
NSGLEAAIDLSSIASEVTVLEFMDTLKGDQVLQDKVNELPNVNIITNAATKEVIGDGKQV
TALQYQDRVSEEIKSITTDGVFVQIGLKANSDAFKDIVETNRMGEIEIDAHNRTSQAGVY
AAGDVSIVPYKQIVIAMGEGSKAALSAFEDKIKNKLMSTEASLA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgttagaacaagcattaaaaacacaagtaactacgtttttcggtcatcttaaaagtcaa
tatacattcgaagttacagtagcagatacacatccaagtaagaacgatatggtttcttta
atggaggacgtagcaagctgttcggataaggtaacgctaaatgtacaatctggagaggga
ttgtcgatgaatattgtaaaggatggagtgccatcaaatattacttttagagcggtaccg
acaggacatgagtttacaacattgttgttggctgtgcttaacatggaaggtattggtaaa
aatctaccagatcaagcgatcatcaataagatcaaaagcattagcgagaaggtagagatc
agtagttatatttcattgtcttgtacaaactgcccagaagtagtacaagcactgaatgta
atgtcgatgaacaacccaaatattacacatcaaattatagatggcggaattaatcaagaa
gaagtagagcaattgggtattcaagcagtacctactgttttagtgaatggagagcaattc
cacgttggtagatcttctttaggagagttactaggaaaattagaggagttagtagaaaca
tcaacagaaaacatcgaagcaatagagaaagaatatgatgttgttgttgtaggtggtgga
cctgccggtgtatcttctgcggtgtattctgctagaaaaggatttaaagtagcagtggtt
gctggtactattggtggtcaggtgaaagaaactgtaggtatcgaaaatatgatctcgatt
acaaaaactactggtgcagaattgacagccaatctgtacaatcacttaaaagattaccct
attgatatcttggagaacagatgggtagaaaatgtagaagtggtagatggttacaagaaa
atcactacttctatgaacgaagtcattactgctcctgcattagttattgcgacgggtgct
agttggagaaaattaggtgtacctggcgaaacagaatacatcggatctggtgtggctttc
tgtacgcactgtgatgctccttactttaaaggtaaaaaagtggttgttgtcggaggcggt
aactctggtttagaggcggcgattgatttatcaagcatcgcatcagaagtgacagttttg
gagttcatggatacgttgaaaggtgatcaagtacttcaagataaggtaaatgaattacct
aatgtaaacataatcactaacgcggcaacaaaagaagtaatcggtgatggtaagcaagta
accgcattgcagtatcaagaccgagtatcagaagaaattaagtcaatcactacagatggt
gtattcgtacaaatcggattaaaagccaatagtgatgctttcaaagatatcgtagagacc
aatagaatgggtgaaatcgaaatcgatgcacacaacagaacatctcaagcaggagtttat
gcagcaggtgatgtttctattgttccttacaaacaaattgtaattgcgatgggcgaaggt
tccaaagcagctttatcagcttttgaagacaagattaaaaataaattgatgtccacagag
gcatcattagcataa

DBGET integrated database retrieval system