KEGG   Flammeovirga sp. MY04: MY04_3129Help
Entry
MY04_3129         CDS       T04442                                 

Definition
(GenBank) Chromosome segregation ATPase-like protein
Organism
flm  Flammeovirga sp. MY04
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4175
Motif
Other DBs
NCBI-ProteinID: ANQ50494
UniProt: A0A1B1FWL8
LinkDB All DBs
Position
1:3932225..3935599
Genome map
AA seq 1124 aa AA seqDB search
MFDHKIRAYKQKLYKNAALKGIILTMAAVLGLFLLINILEYINNFGTTARAILFFTYILT
FAYTFYIWVIQPIAQLKGFKKQITDEEAAKNIGTFFPEISDKLINSIQLQAKEKDNSLIQ
ATLQKRNRQFDPINFTHAISYKENLKYSYRYLLPAVIIFFGILLIKPQIITDTTPKIVQF
DKEFLPVAPFRFELLNSDLKTFQGDDFELNLKLSGDVIPADVYLETNKGSIIKLQYNPLD
KTFSHTFKKIQHDVKFRFKAAGYFSTEHHITTLTRPSLSQFSVQVDYPRYTGKNNETLSN
TGNLLLPEGSKITWLFDTKTADSIAIYFKESDKTVEADGIKKNVFKYVHEATMSTAYSVS
LKNIYGSNRDSISYYLNVIPDKFPSINMKQYQDTVMFDYLVFGGNISDDYGITRLRTRYR
IKRNGDKKPPRTFEKMDIPFNNKAIDQSFYYKLETNQFDLKEGDKLEYYVEVYDNDAVNG
NKRSKTPMYTFTLPTKAELEKEIDQSKKETENKLDDTLDKANQLEKDLKKLEEKLKGKRQ
LTWQDKKDIQKLIEKRKELEEQLKSLQEQSQQLQNKQDKFSNQDKSTSDKAEQLQKIIND
INDEETQKLYEELQKLMEQNYINQNLQENLQNIENKQKNLKNELERTIKLFKKLQIEQKA
KEVSSKLEDLAKEQQDLANKTKELEEEEKKEGLSEEEKKDNKSEEDALKKDQEELNKKFE
DIKKEMEELRKMDKKEQTNQDFEQFTPNERQISKEQQNASEQLNQDKKKDAHQSQKKAAN
KMQQMAQKMQQSMQSSQMEQISEDHEALRQIMENLLKLSFDQENLMESFKEVRRIDPKFV
ELSQTQLKLKDDAKYIEDSLIALSKRVFQIESFVTREVTQMNKYMDESLDAIKRRVPEIA
ASKQQFTMTSINNLALLLNDILENMQQQMSQNMAGQQMNQKQQQSSSPSMSQMQQQLNQQ
MQNLKKSGKSGKELSKELAKLAAQQEMIRNALKQSMGKGEEQMQGKEDEEGEKGGGNGYG
KILKEMEKTEEDLVNKRLTDKLIQRQQEILTRMLESEKAKKEKGKDEERKAETAKQQKQV
PPPDSFDEYLKQKETQIELLRTIPTSLNTYYKQEVNKYFENIKD
NT seq 3375 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatcataaaatcagagcctataaacaaaaactatataagaacgctgctttaaaa
ggcataattcttactatggctgcagttttaggtctttttttattaataaacatattagag
tatatcaataattttggtacaactgcgagagctattctcttctttacgtatatcttaacc
tttgcttatactttttacatttgggtgattcaacctatcgctcaattaaaaggtttcaaa
aaacaaataacagacgaagaagcagcgaaaaatatcggaacattttttcctgaaatatca
gataagctgatcaactctatacaacttcaagcaaaagaaaaggacaatagcttaatccaa
gctactttacaaaaaagaaatcgtcagtttgatcctatcaattttacacatgcaatttct
tacaaagagaatttaaaatattcatatcggtatctattacctgctgtgatcattttcttt
gggatattacttatcaaacctcaaatcattacggatactacaccaaagattgtacagttt
gataaagagtttttacctgttgctccttttagatttgaattattaaatagtgatctaaaa
acttttcagggtgatgatttcgaattaaaccttaaattaagtggtgatgtaattccagct
gatgtttatttggaaacaaacaaaggctctattatcaaattacaatacaatccacttgat
aaaacgttttctcacactttcaaaaaaattcaacatgatgtaaagttcagattcaaggct
gctggatatttttcaactgaacatcatattaccactttaacacgaccttctttatctcag
tttagtgttcaggtcgattaccctagatacacgggtaagaataatgagacgctttccaat
actggtaatttattacttcccgaaggatccaagatcacttggctgtttgatactaaaaca
gctgattctattgccatctattttaaagaatcagataaaactgtagaagcagatggtatc
aagaagaacgtatttaaatacgttcatgaagctactatgtcaaccgcttacagtgttagc
ttaaaaaatatttatggtagtaacagagacagtatttcttattacttaaatgtgattcct
gataaattcccaagtataaatatgaaacagtatcaagatactgtgatgtttgattactta
gtctttggaggaaacatcagtgatgattatggtattacacgtttaagaacgagatataga
ataaaacgaaacggagacaagaaacctccaagaacgttcgaaaaaatggatatccctttt
aataataaagcgattgatcaaagcttttattataagttagaaacgaatcagtttgatcta
aaagagggggataaactagaatattatgtagaggtatatgacaatgatgcagtcaatggt
aataagcgaagtaaaacgcctatgtacacctttaccttaccaactaaagctgagttagaa
aaagaaattgatcagtcgaagaaggagactgaaaataaattagatgatactttggacaaa
gccaatcagctggagaaagatttaaagaagttagaagagaagctgaaaggtaagcgtcag
ttaacttggcaggataaaaaagatatccaaaaactcatcgaaaagagaaaagaattagaa
gaacaattaaagtctcttcaggaacaaagtcagcaattacaaaacaagcaagacaagttc
tccaatcaagataaaagtacctctgataaagcggaacaacttcagaaaatcattaatgac
attaatgatgaggaaacacagaagttatatgaagaactacaaaaattgatggaacaaaac
tacatcaatcagaatcttcaggagaatttgcaaaacattgaaaacaaacagaagaactta
aagaacgaattagaacgaacgattaagcttttcaaaaaattacagattgaacaaaaagca
aaagaggtttcttctaaattagaggacttggcaaaagaacaacaggacctagccaataaa
acaaaagagttagaagaggaagagaagaaagagggattatctgaggaggagaaaaaagat
aataagtcggaggaagatgcacttaaaaaagatcaggaagaactgaataaaaagtttgag
gacatcaagaaggagatggaagaactgagaaaaatggacaagaaagaacagaccaatcag
gacttcgaacagtttacccctaatgaaagacagatctcaaaagaacaacaaaatgccagt
gaacagctgaatcaagataaaaagaaagatgctcatcagtctcagaaaaaggcggctaat
aaaatgcagcagatggcacaaaaaatgcaacaaagtatgcagtcatcacagatggagcaa
atcagtgaagatcacgaggctttacgtcaaataatggaaaatcttcttaaactttccttc
gatcaggaaaatcttatggaatcatttaaggaagttagaagaatcgaccctaaatttgtg
gagttgtcacaaacacaacttaaattgaaagatgatgctaaatacattgaagatagttta
attgcattatcaaaaagagttttccaaattgagtcttttgtgactcgagaggtgactcaa
atgaataagtatatggacgaaagtctagatgctatcaagcgtagagtcccggaaattgca
gcaagtaagcagcagtttacaatgacttctataaataatttagcattgctcttaaacgac
atattagagaacatgcaacagcagatgagtcagaacatggctggtcagcaaatgaatcag
aagcaacaacaatcttcttcacctagcatgagtcagatgcaacaacagttgaatcaacaa
atgcagaacttgaagaagtctggtaaatcaggaaaagaattatccaaggaattggctaaa
ctcgccgctcaacaggaaatgatccgaaatgctttaaaacaaagtatgggtaaaggtgaa
gagcaaatgcaagggaaagaagatgaagaaggtgaaaaaggcggtggtaacggttatgga
aaaatcctcaaagaaatggaaaaaacggaagaggatttggtaaataagcgtttaactgat
aagttgattcaaagacaacaagagatcctaactaggatgttggagtctgaaaaagcaaaa
aaagaaaaaggtaaagatgaagagaggaaagccgaaactgccaagcagcagaagcaggtt
ccacctccagatagcttcgatgagtatttaaaacaaaaagaaacacaaattgagctatta
aggacgatcccaacttcattaaatacgtattataaacaagaagtaaacaagtactttgaa
aatataaaagattga

DBGET integrated database retrieval system