KEGG   Flammeovirga sp. MY04: MY04_3731Help
Entry
MY04_3731         CDS       T04442                                 

Gene name
lpxC
Definition
(GenBank) Preprotein translocase ATPase subunit
  KO
K16363  UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase / 3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:3.5.1.108 4.2.1.59]
Organism
flm  Flammeovirga sp. MY04
Pathway
flm00061  Fatty acid biosynthesis
flm00540  Lipopolysaccharide biosynthesis
flm01100  Metabolic pathways
flm01212  Fatty acid metabolism
Module
flm_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:flm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    MY04_3731 (lpxC)
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    MY04_3731 (lpxC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:flm01005]
    MY04_3731 (lpxC)
   01004 Lipid biosynthesis proteins [BR:flm01004]
    MY04_3731 (lpxC)
Enzymes [BR:flm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.108  UDP-3-O-acyl-N-acetylglucosamine deacetylase
     MY04_3731 (lpxC)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     MY04_3731 (lpxC)
Lipopolysaccharide biosynthesis proteins [BR:flm01005]
 Lipid A
  MY04_3731 (lpxC)
Lipid biosynthesis proteins [BR:flm01004]
 Fatty acid synthase
  Component type
   MY04_3731 (lpxC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LpxC FabA MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: ANQ51075
UniProt: A0A1B1FY72
LinkDB All DBs
Position
1:4685650..4687017
Genome map
AA seq 455 aa AA seqDB search
MTVEGVGIHTGAISKMVFLPAEENHGYKFQRVDIEGQPTVDCDVDNVVDVSRGTTIEQDG
ARVNTVEHVLAALVGLQIDNVLIQIDGPEPPIMEGSSIKFVEALMEVGLEEQQSLRNFFE
VPEGVFYKEDDRKVEIAALPLNDYRLTVMVDYNSPVLGSQHAALNNIEDFAAEIASSRTF
CFLHEVEALRKANLIKGGNFNNAIVVVDQVVNQETLDDLAELFELPSVEVAEEGILNNVE
LRHPNEPARHKLLDMVGDLALVGRPIKGQILAARPGHAANVAFARKLKSLMLKSARKNVP
TYDPLQAPIYDINQIEELLPHRYPFRLVDKITEITDKYVIGVKNVTINEEFFMGHFPSNP
VMPGVLQIEAMGQTGGILVLNSVDNPANYWTYFVGVEECKFRRMVVPGDTLVIKCELLMP
IRRGIAKMKGQAYVGDKLVTEAIMTASLVKKDNNA
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtagaaggcgttggtattcatacaggagccattagtaaaatggtatttttacct
gcggaagaaaatcacggttacaaatttcaaagagttgacatcgaaggtcagccaacagtg
gattgtgatgtagacaatgtagtagatgtttctcgcggaactacaattgaacaagatgga
gcaagagtaaatactgttgagcacgttttagcagctctagttggattacaaattgataat
gttttgatccaaattgatggtccagaaccaccaattatggaaggaagttctattaaattt
gtagaagctttaatggaagtaggcttagaagagcaacaaagcttgcgtaacttctttgaa
gttccagaaggagtattctataaggaagatgatagaaaagtagaaattgctgcattgcca
ttaaacgattaccgtttaactgtaatggtagattataactctccagtacttgggtctcag
catgctgctttaaataatatagaagattttgctgcagaaattgcatcatcaagaactttc
tgcttcttacatgaagtagaggccttaagaaaagccaaccttattaaaggtggtaacttt
aataatgccattgttgttgttgatcaagtagtaaatcaagaaactttagacgatttagct
gagttgtttgaattaccatcagtagaagttgctgaagaaggtattttgaataacgtagag
ttacgtcaccctaatgaacctgcacgtcataaattgttagacatggtaggtgatttagca
ttagtaggtagaccaattaaaggtcaaattttagcggctcgtccaggtcacgctgccaac
gtagctttcgctagaaaattaaagagtttgatgttgaaatcagctcgtaaaaatgtacct
acttacgatcctcttcaagctccaatatatgatattaatcaaattgaggagttactacca
cacaggtatccatttagattagttgataagattacagagattactgataagtatgttatt
ggtgtgaaaaatgtaacgatcaacgaggaattctttatgggtcacttcccaagcaaccca
gtaatgccgggtgtacttcaaattgaagcaatgggacaaacaggtggtattctagtattg
aactctgtggataaccctgcaaattactggacttactttgttggtgtagaagagtgtaag
tttagaagaatggtagttccaggagatacattggttatcaaatgtgaattattgatgcct
attcgtagaggtatcgcaaagatgaaaggtcaagcttatgtaggtgataaactggttaca
gaagcaattatgacagcatctttagtaaaaaaagataataacgcttaa

DBGET integrated database retrieval system