KEGG   Flammeovirga sp. MY04: MY04_5322Help
Entry
MY04_5322         CDS       T04442                                 

Definition
(GenBank) Alpha-amylase type B isozyme
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
flm  Flammeovirga sp. MY04
Pathway
flm00500  Starch and sucrose metabolism
flm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:flm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MY04_5322
Enzymes [BR:flm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MY04_5322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM26 Alpha-amylase CHB_HEX_C_1 Alpha-amyl_C2 Fn3_assoc
Motif
Other DBs
NCBI-ProteinID: ANQ52654
UniProt: A0A1B1G2S2
LinkDB All DBs
Position
2:1875603..1878560
Genome map
AA seq 985 aa AA seqDB search
MNYLFTSSDKLNESIITYFFLIEMKKHLLRSLSIIGAILFFTSFSSFAQQGNRSDVLLQG
FHWEAADATKKDWWQNLNSKVEEISDAGFDAVWLPPPSDAADRAGYLPRKWYDLNSNYGT
EAELRTLVQNLGNNNVQAIADIVINHRVGTTGWADFTEPSLGGCSSICSDDEVNWASNST
EQGAACGDNDSGTQYEAARDLNHNSFTVRDEIKKWMTWLKNDVGFDGWRYDFVHGFNAYY
FAEYNNHTSPYISIGEQWKPYDEIVGWLNGAQNTSSAFDFPLKYTLHDAVRGNYNYLNGL
PSLLGTHGSQAVSFLENHDTEPVRSEYGDNSFPNNPSDNSQLLQGYAYILTHPGVPVVFY
SHYFNYGIQDALKEMIAIRKANGITNTSYVQVEGTNDNNYYAAIIDGKVAMKIGGGNWSP
GNGWNLKASGPGYAIWDQGTVVTLPTLTLNTPSGNFPGGCANINLSTSSGDIYYTTNGDI
PTDQSTRYNGEFEVCGQAGETVVVKAVAIDQNGSSDVVEGTYTFNEAASMTVYFKPPNGG
TPSIYFWAVTDGDDTTTWPGENMQVSSAYDGFYEYTINGSCTNLILLENGSKITGDEENI
CGNVWYDNGWIDEPLPPTPDTVAPVVSISPNGGDYLDEVQVTISATDDRDASPVIYYSIN
GGTNQTAISTTTFTLDADATVDYYAMDASDNSSDVQTATFSVTPSPTPEGGFKVYVQGYN
MIHHWGASPVGSVASTNWPGATMTQENGWFVYEFPIEVVSTNLLFHDGNGNQTDDYTRDK
DGWYKDGQWYDQEPVAPEPGNGLRIHYKSSWGNSTRIHYWGASNGASSNWPGELMTSEGN
GWYAYTIEGATSSNLLFHNGSGAQTSDLNRSGEGWYKDGVWYNSNPESSSSRLVGGSLDL
EDQLLTLFPTQVTNEFTIDFNLNQPSKVFMQAFDLNGQQVLQPINKELLNGHHQLKVDAL
GLSSGMYIVKIQLGDALHIKRIIVQ
NT seq 2958 nt NT seq  +upstreamnt  +downstreamnt
atgaactacttatttacatcatctgataaactaaatgagtctattattacttactttttt
ttaattgaaatgaaaaaacatctactacgctctttgtccattattggagctatactattt
tttacatccttcagttcgttcgcacaacaaggcaacagaagtgatgtccttttacagggt
ttccattgggaagctgctgatgctactaagaaagattggtggcaaaatctaaacagtaaa
gtagaagaaatctcagatgcagggtttgatgccgtatggcttccacctccctctgatgct
gccgaccgcgcgggttatctacctaggaaatggtatgatttaaactctaactacggaaca
gaagctgagctaagaactttggtgcaaaatctaggtaataacaacgttcaagctatcgct
gatatcgtaattaaccacagagtgggtacaacaggttgggccgattttacggaaccttct
cttggtgggtgttcttctatttgttctgatgatgaagtcaattgggcatcaaatagtacc
gaacaaggtgctgcctgtggcgataatgattcgggtacacaatacgaagctgctcgagat
ctaaaccacaactcattcactgttcgagacgaaatcaaaaagtggatgacatggttaaaa
aatgacgtgggatttgatggttggagatatgactttgttcatggtttcaatgcttattat
tttgctgaatacaacaatcacacaagtccttacatttcaattggtgagcaatggaaacct
tatgatgaaattgtaggatggttaaatggagctcaaaatacttcatcagcatttgatttt
cctttgaagtatactttacatgatgctgtgagaggtaactacaattatttgaacggttta
ccaagtttattaggcactcatggttcacaagcggtttctttcttagaaaatcacgatact
gagccagtaagatcagaatatggcgacaattcattccctaacaatccttcggataactct
cagcttttacagggatatgcttatatcctaactcacccaggagttcctgtagtattctat
tctcattactttaattacgggattcaggatgcactaaaagaaatgattgctatccgtaag
gcaaatggaattacaaatacaagttatgtacaagtagaaggtacaaacgataataattat
tacgctgcgattatagatggtaaagtagccatgaagatcggtggaggcaactggtctcct
ggaaatggatggaacttaaaggcttctggtcctggatatgctatttgggatcaaggaact
gtggttactttacctactctaacattaaatactcctagcggtaacttccctggtggatgt
gcaaatatcaacttatcaacaagcagtggcgatatctattatactacaaatggtgatatc
ccaacggatcaatctacaagatataatggtgagtttgaagtgtgtggacaggctggagaa
acagttgtggtaaaagcagtagcgatcgatcaaaatggatcttctgatgtggtagaaggt
acatatacgttcaatgaggctgcaagcatgactgtttactttaagcctccaaatggcggt
actcctagtatttacttctgggcagtaactgatggagacgatacaactacctggccaggc
gaaaatatgcaagtatcttctgcatatgatggattctatgaatacaccataaacggttct
tgtactaacctaattcttttagaaaatggtagtaaaataaccggagatgaagaaaatata
tgtggtaatgtatggtatgataacggttggattgatgaaccacttccacctacaccagat
acagttgcacctgtagtttcaatttctccaaacggaggcgattatcttgacgaggttcaa
gtcactattagtgctactgatgatagagatgcttccccagtaatttattattctatcaat
ggcggaacaaatcaaacggcaatttcaacaacaacttttactttagatgcagatgcaact
gtagattattatgcaatggatgcttcagataattcttctgatgttcaaactgctactttc
tcagtaactccatctcctactcctgaaggaggatttaaagtatacgtccaaggttataat
atgattcaccactggggtgcatctcctgtaggtagtgtagcaagtacaaattggcctgga
gcaaccatgactcaggaaaacggttggtttgtatatgaattcccaatcgaagtggtttct
accaacttattattccacgatggaaatggtaatcaaaccgatgattacactagagataaa
gatggatggtacaaagatggtcagtggtacgatcaagaacctgtggctccagaaccagga
aacggtttaaggatccattataaatcatcttggggtaatagcacaagaatccattattgg
ggtgcttctaatggtgcaagctctaattggccaggcgaattaatgacttcagaaggcaat
ggatggtatgcatacactatcgaaggagcaacttcatctaacttattattccacaatggc
agtggagcccaaacttctgatttaaacagatcgggcgaaggatggtataaagatggcgtt
tggtataactctaatcctgaatcatcatcaagtagattggtaggaggaagtttagacctc
gaagatcaattattgacattattcccaactcaagtaacaaatgagttcactatagatttc
aacttaaatcagccttcaaaagtgtttatgcaagcatttgatttaaacggacagcaagtg
cttcaacctatcaacaaagaattattaaacggacatcatcagttgaaggtagatgctttg
ggcttatcaagtggaatgtatatcgttaaaattcaattaggtgatgcactgcacatcaaa
cgaatcatagtacaataa

DBGET integrated database retrieval system