KEGG   Filimonas lacunae: FLA_0616Help
Entry
FLA_0616          CDS       T05172                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
fln  Filimonas lacunae
Pathway
fln00620  Pyruvate metabolism
fln00680  Methane metabolism
fln01100  Metabolic pathways
fln01120  Microbial metabolism in diverse environments
fln01200  Carbon metabolism
Module
fln_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:fln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    FLA_0616
  09102 Energy metabolism
   00680 Methane metabolism
    FLA_0616
Enzymes [BR:fln01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     FLA_0616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: BAV04624
UniProt: A0A173MAP0
LinkDB All DBs
Position
730173..732740
Genome map
AA seq 855 aa AA seqDB search
MDNVLQQYKNLVAIRFQLYNSLFTSLPFHRIEKTGVLLSLFLIHCEEGYRKQQSPNDIIT
SFMEQYTPYRKEQELLDLLFRFIQYAERQVVLFDALEDAAFCNTHDMNGPGSLKHLQSEV
IQKGKQGALAEKMKRFSIRMVLTAHPTQFYPGEVLGIISDLAKALSNADSATVNEYLQQL
GKTPFLKREKPKPYDEAVSLLWYLENIFYPASGKILSEIKSQFPDAVDANNPLIHLGFWP
GGDRDGNPFVTSDTTVKVAESLRRSIMKCYYLELRKLRRRLTFKGISDALLNLENQLYTN
LFVKEYPCDVCGNQLLKTLLEIRETLITQHNGLFLYKLENLISKVQVFGLHFASLDVRQD
SGVHGKLIEDILAHTKLLPANYQQLDEDGKIAALMNVKELEDIAVLDDELSRDCVETVRA
IKGIQQVNGEKGCHRYIISHTTSAVNIMEVYGLFMLSGWDKKALTIDIVPLFETVEDLQN
AGAAMQKLYAIKEYRAHLEARGNTQTIMLGFSDGTKDGGYLMANWSIYKAKEELTRISRE
YDIDVVFFDGRGGPPARGGGKTHKFYASMGQNIANNEIQLTIQGQTISSNFGTIDSAQFN
IEQLINAGISNELFAPRRDTLSAEEDALLNQLAVDSFDSYVKLKNHPYFLEYLGHASPLR
FYSQTNIGSRPAKRGSSNQLSLNDLRAIPYVGSWSQLKQNVTGYYGVGQALKKMDEAGRW
NEVSSLYKSSLLFKTLMDNCEMSMKKTFFPLTAFLSEHPKYGEIWNLIYAEYELTKKYVL
RLSGNADLMGDYPVDQLSIQMRERIVLPLLTIQQFGITKVRELEEQLIDSPVKSNYEKMV
MRCSFGIINAGRNSV
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atggataacgttttacaacaatacaaaaacctggtagccatcaggttccaattgtataac
agtcttttcacctcccttccctttcaccgtatcgaaaaaacgggagtgctgttatcgctg
ttcctgatacattgcgaagaaggctacagaaagcaacagagccctaatgacatcattacc
tcttttatggagcagtacaccccgtatcggaaagaacaggagttactggatctgttgttt
agatttatacaatatgccgaaaggcaggttgtgctgtttgatgccctggaagatgcagct
ttctgcaacacccatgacatgaacggtcccggcagtttaaaacacctgcagtcggaagtg
atacaaaaaggcaagcagggagcgctggccgaaaagatgaagcgtttttccattcgcatg
gtgttaactgcgcatcctacccagttttatcctggcgaggtattgggcattatcagcgat
ctggcaaaagccttatctaatgccgatagcgctacggtaaacgaatacctgcaacaattg
ggcaaaacgcctttcctcaaaagagaaaaaccgaaaccatacgatgaggcggtaagcctg
ttatggtatctcgaaaacatattctaccccgcttccggcaaaatactcagtgaaataaaa
tcgcagttcccggatgcggtggatgccaacaacccgttaattcacctgggcttctggcct
ggtggcgacagggatggtaaccctttcgtaacctccgatactacggtaaaggtggccgaa
tcgctgcgtcgcagcattatgaagtgctactatctggagctgcgtaagctgcgtcgccgt
cttacctttaaaggtatcagtgatgcgttgctgaacctcgaaaaccagttgtataccaac
ctgtttgtgaaagaatatccttgcgatgtttgtggcaaccagctgttgaaaacattactg
gaaataagggaaacgcttattacccagcacaatggtctgttcctgtacaaactggaaaac
cttattagtaaggtgcaggtgtttggtttgcactttgcttcactggacgtgcgtcaggac
agcggtgttcatggtaagctgattgaagacatcctggctcatacaaaactgttgccagcc
aactaccagcagctagatgaggacggcaaaattgccgcgctgatgaacgtaaaagagctg
gaagatattgctgtgctggatgacgaattaagtcgcgactgtgttgaaacagtacgtgcg
ataaagggcattcaacaggtgaacggcgaaaaaggttgtcaccgctatatcatcagtcat
actaccagcgctgtaaacatcatggaggtgtacggtttgtttatgctgagtggctgggat
aaaaaagcactgaccattgatatcgttccattgttcgaaactgtggaagatttacaaaat
gcaggtgctgctatgcagaagctgtatgctatcaaagagtatcgtgcacacctggaagcc
cgtggcaacacccaaaccatcatgttaggcttctctgatggcactaaggatggcggttac
ctgatggctaactggagcatttataaagcgaaagaagaattaacccgcatatcccgtgaa
tatgatatcgatgttgtgttctttgatggcaggggaggtccaccagcccgtggggggggg
aaaacgcataagttctacgcttctatgggccagaatatcgccaacaacgaaattcaatta
accatacaagggcaaaccatcagctctaatttcggcactatcgactctgcccagtttaac
attgagcagttaatcaatgccggtatttccaatgagttgtttgcaccacgcagagataca
ctttctgccgaagaagatgcactgttaaaccaactggctgtagatagctttgattcttat
gtgaagctgaaaaatcatccttacttcctggaatatctgggccatgccagtccgttacgt
ttctattcacaaaccaacataggtagtcgtcctgctaaaagaggttccagcaaccagtta
agcttaaacgatctcagggccattccttatgtaggttcctggagccagttaaagcaaaac
gttaccggttactatggggtaggccaggcgttaaagaaaatggatgaagccggcaggtgg
aacgaggttagcagcctgtataaaagcagtctgttgtttaaaaccttaatggacaactgc
gaaatgtctatgaaaaagacatttttcccgctcaccgctttcttatcagagcatccgaag
tacggcgaaatctggaatctgatctatgctgaatacgaattaaccaaaaagtacgtgttg
cgtttatccggtaatgcagatctgatgggtgattacccggttgatcagttgtctatccaa
atgcgtgagcgtattgtgttgccgctgttaaccattcagcagtttggtatcaccaaagtg
cgcgaactggaagagcagttaattgattctccggtgaaaagtaactatgagaaaatggta
atgcgttgctcatttggcatcatcaacgcaggtcgcaactcggtataa

DBGET integrated database retrieval system