KEGG   Filimonas lacunae: FLA_1449Help
Entry
FLA_1449          CDS       T05172                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
fln  Filimonas lacunae
Pathway
fln00564  Glycerophospholipid metabolism
fln01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fln00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    FLA_1449
Enzymes [BR:fln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     FLA_1449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 GIDA HI0933_like Pyr_redox_2 Thi4 NAD_binding_8 Pyr_redox_3 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: BAV05442
LinkDB All DBs
Position
complement(1782497..1784044)
Genome map
AA seq 515 aa AA seqDB search
MQLETTTEWDVIIIGGGATGLGAAMDAASRGFKTLLTEQADFAKGTSSKATKLVHGGVRY
MAQGDLGLVREACFERGKLLQNAPHLTRNTSFVIPNYSWFDNIKYTVGLKFYDFLAGKLS
LGKSRYISVRHTLEKLPNIKKEGLKGGVEYHDGQFDDARLALNVAQTAAEKGACVLNYFK
VTGLLKGGNGKITGIKAKDIETGKEYEAKGKVVINATGVYVDNVLQMDKPNAPHFVRPSQ
GVHLTLDRSFLPGEAALMIPKTDDGRVLFAVPWHNKLIVGTTDTLREVPELEPRALEEEI
NFILNTATRYLVKKPTRTDVLAVFAGLRPLAAPQGEGKSTKEISRSHKIMVSDSGLITII
GGKWTTFRRMAQDTIDKAIQVASLPANACVTADMPIHGYDTTVDHHNEMHVYGSDIRSLK
ALEAAEPALQAPLLDNYPFTLANVVFAVRDEMALHVEDVLSRRIRLLLLDSKAAVAIAPR
VAAAMAAELGKDEQWIEKEIKDFTELATKYEMEFF
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
ttgcaactggaaactactaccgaatgggatgtcatcattattgggggcggggctaccggg
ttaggcgcagcaatggatgccgcttcccgtggatttaaaaccctgcttaccgagcaggcc
gattttgccaaaggcacttccagcaaagctaccaaactggtgcatggcggggtgcgttac
atggcgcaaggcgatttaggactggtaagagaagcttgttttgaaagaggcaaactgctg
caaaacgccccacacctcacgcgcaatactagtttcgtaattcctaactactcctggttc
gacaatatcaaatataccgttggtttaaaattttacgatttcctggcaggtaagcttagc
ctgggtaaatcgcgctatatctctgtacgtcataccctggaaaagctgcccaacattaaa
aaggaaggcttgaaaggaggtgtagaataccacgacggccagtttgacgatgcccgactg
gcgctgaacgtagcccagaccgcagcagaaaaaggagcctgtgttttgaattatttcaag
gtaacgggcctgctgaagggtggcaatggaaagatcaccggtattaaagcgaaagatatc
gaaaccggaaaagaatacgaagcgaaaggaaaagtggtgattaatgccaccggtgtgtac
gtagataatgtgctgcaaatggacaaacctaatgctccacactttgtgcgtcccagccag
ggcgtgcaccttaccctggacagatcgtttttaccaggtgaagctgcccttatgatccct
aaaacggatgatggccgcgtactgtttgccgttccgtggcataataaactgattgtaggt
actaccgataccctgcgtgaagttccggaactggaaccccgcgcactggaagaagagatc
aattttatattgaataccgccacacgttacctggttaaaaaacctacccgtacggatgta
ctggcggtgtttgccggccttcgtccgctggccgccccacaaggcgaaggcaaaagcacc
aaggaaatatcccgcagccataagatcatggtatctgacagcggcttaattaccatcatt
ggtggtaaatggaccaccttccgccgcatggcgcaggatactattgacaaagccatacag
gtagccagcctgcctgctaatgcctgcgttactgccgacatgcctatacatggttatgat
acaaccgtagatcatcataacgaaatgcatgtatatggctctgatatcagatcattaaaa
gccctggaagctgccgaaccagctttacaagctcctttgctggacaactatccttttaca
ttagccaatgtggtgtttgccgtgcgtgatgaaatggccttgcacgtagaagatgtgttg
tcgcgccgtataagactgttgctgttagactcgaaagcagccgtagcaatagccccccgt
gtagcagccgctatggccgctgagctgggaaaagatgaacaatggatagaaaaggaaata
aaagactttacagaactggccactaagtacgaaatggaatttttctaa

DBGET integrated database retrieval system