KEGG   Filimonas lacunae: FLA_3659Help
Entry
FLA_3659          CDS       T05172                                 

Definition
(GenBank) alpha-glucosidase SusB
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
fln  Filimonas lacunae
Pathway
fln00500  Starch and sucrose metabolism
fln01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FLA_3659
Enzymes [BR:fln01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     FLA_3659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C
Motif
Other DBs
NCBI-ProteinID: BAV07633
UniProt: A0A173MJ12
LinkDB All DBs
Position
complement(4459684..4461801)
Genome map
AA seq 705 aa AA seqDB search
MTKLKQVLYLLAGLALWQHAIAQPAARVKAAMGKVQLQFDLDKEGAPQYAVWLGNQKAIL
PSALGLVLQQGALNKGFTLLSSTTTTTDTTWQPVWGEQANITDKHTQVVVHLQHQSTGYL
LDIVFRVFADGVGFRYQMPQQKNLLHCVVTDESTAFRLPGNYKAFWIPGDYDTNEYEYTT
SRLTEIDNTALVKNSTDIAVRVTPDNRSVQTPLMLKGDDGLYINIHEAALINYPAMQLHV
SADSLLLRASLVPDAYGNKAYVQAPFHTPWRTIIISDKATDILASKMILNLNEPSKAGAN
TSWIQPMKFAGVWWEMQTGLSTWSYATAPDNTDAQGHLIPSGKHGANTANVKRYIDFAAE
SGIPGVLVEGWNVGWEDWFGNWKENVFDFVTPYPDFDVTALQQYAAAKGVHLIMHNETSG
SATNYERNMDTAFRFMKQFGYPAVKTGYVGKIIPRGEHHDGQWMVNHYERVAQKALQYQV
MLDAHEAVRPTGLQRTYPNWMACEAGRGNEYNAFTNNGNAPEHETILPFTRLMGGPMDYT
PGIFKLKGYAAGAPDRQLHTTLAKQLALYVTIYSPLQMVSDLPENYRAHPDAFRFIKEVA
VDWDDTKILEAEPGDYVTIARKAKGKPDWFIGGITDENSRVATVNCSFLEKGKQYQATIY
EDAANAHWKNNPEAYHIRTVPVNSESKLSLPLSAGGGVAVHIALK
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaactgaaacaggtactttacctgttggcggggctggcgttatggcaacatgcc
atagcgcagcctgcagccagggtaaaggcagcaatgggcaaagtgcagttgcaatttgat
ttagataaagagggggcaccgcaatatgcggtatggttgggcaaccagaaagctatattg
ccatcggccctgggattggtgctgcaacaaggggcattgaacaaaggctttacgttgtta
tcttctaccaccaccaccactgatactacctggcaaccggtatggggcgagcaggccaat
attaccgacaagcacacacaggtggtagtgcatttgcaacaccagtctacgggttatttg
ctcgacattgtgtttcgggtgtttgccgatggtgtgggctttcgttaccagatgccacag
caaaagaacctattgcattgtgtggtaacagatgagtctaccgcctttcgtttgcccggt
aactataaagccttctggatacccggcgattacgataccaacgagtatgagtataccacc
agccgcctgacagaaatagataatactgccctggtaaagaacagcacagatattgccgta
agggtaacacctgataacaggtcggtacaaacacctttgatgttgaagggggatgatggt
ttatatatcaatattcacgaagccgctttgatcaactacccggctatgcaattgcatgta
tcggccgattcgctgttgctgcgggccagccttgttcccgatgcctatggcaacaaagcc
tatgtgcaggctccttttcacaccccttggcgtactattatcataagcgacaaagccacc
gatatactggcttctaaaatgatcttaaacctgaacgagccttctaaagcaggtgctaac
accagctggatacagcccatgaagtttgcaggggtttggtgggaaatgcaaactggattg
agtacctggagttatgctaccgcacccgacaataccgatgcgcaggggcatttaataccc
agtggtaagcatggagctaacactgccaatgtaaaacggtacatcgattttgcagcagaa
agtggcatacccggcgtgctggtagaaggctggaatgtgggttgggaagactggtttggt
aactggaaagagaatgtgtttgactttgtaacgccttatcccgattttgatgtgactgcg
ctacagcaatatgcagcagccaaaggagtacacctgatcatgcacaatgaaacatcgggc
agcgctactaattacgaaaggaatatggataccgctttccggtttatgaagcagtttgga
tatccggcggtaaaaaccggttatgtaggcaaaataataccccgtggcgagcatcacgat
ggacagtggatggtaaaccattatgagcgtgtggcacaaaaagcattgcaataccaggta
atgctggatgcacacgaagcggtaaggcccaccggcctgcagcgtacttatcctaactgg
atggcctgcgaagcgggtcgaggcaatgagtacaatgcctttaccaacaatgggaacgcc
ccggagcacgaaaccatactaccctttacccggttaatgggtggccccatggattataca
cccggcatctttaaactgaaaggatatgctgccggtgcgccggacaggcagttgcatacc
accctggctaaacagctggcgttatatgtaaccatatatagtccgctgcaaatggtaagt
gatctgccggagaattaccgtgcgcaccccgatgccttccggtttattaaagaggtggca
gtagattgggacgatactaaaatactggaagctgaaccgggcgattatgtaaccatagcc
cgtaaggctaaaggcaagcccgattggtttataggaggtattacagacgagaacagccgg
gttgctaccgtcaattgttcctttttggaaaaaggaaagcaataccaggccactatttac
gaagatgcggccaacgcccattggaaaaataacccggaagcttatcatattcgtaccgtg
ccggtaaacagtgaaagtaaattaagtctgccgctgtcggccggtgggggggtagctgtg
catattgcattaaaataa

DBGET integrated database retrieval system