KEGG   Filimonas lacunae: FLA_6428Help
Entry
FLA_6428          CDS       T05172                                 

Definition
(GenBank) ATP-dependent DNA ligase clustered with Ku protein, LigD
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
fln  Filimonas lacunae
Pathway
fln03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:fln00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    FLA_6428
Enzymes [BR:fln01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     FLA_6428
DNA repair and recombination proteins [BR:fln03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     FLA_6428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: BAV10366
UniProt: A0A173MS60
LinkDB All DBs
Position
7794038..7796782
Genome map
AA seq 914 aa AA seqDB search
MSLARYKQKRSFSHTPEPAGGKASSGRLRFVIQKHDASHLHYDFRLEMDGVLKSWAVPKG
PSTDPSVKRLAMMVEDHPYDYRTFEGIIPEGNYGAGTVIVWDEGTYEPLEQAKTKKEQEK
LLLKQLNAGSLKFALHGKKLKGEFALVHTHGRGENSWLLIKHRDKYAATTDITKKDKSVV
SGKTLAKVEATSTHIYGEDHKEPDTAGKVKVPVKKVAANKTAAKTAFKKTAAKKAVKPKS
ATTQAVKKKAPATQGVKKAFPKNSSPMLATLVDKPFDEEGWLYEIKWDGYRALTLKHGKS
TELVSRNQKSFNEKFYPIYEAVKQWKVDAVVDGEIVVVNKNGVSNFGLLQNWRSEADGDL
YYYVFDLLWLNGYDVTSLPLQQRRQLLKEQLPSPDGPIRMSENFNATATEFLAAAAETGL
EGIIAKKENSKYEPGNRSRNWLKMKTGKRHEVVIGGFTQNKGSVKLFSSLLVGVYENGKL
QYTGKIGTGFTEAMQKDMMKQFKPLITSKLPFEQEPDVNKPSRFRPDPPHASVTWLRPKL
VCEVSYTEITSDGVMRHPSFEGMREDKKAKDVKREIAVPVKTVKENKSALHTSKVLQPAG
KTARKTLLNPTDESQVRKVNGQELSFTNLDKIYWPKDKISKRDMLNYYYQVAPYILPYIK
NRPQSLNRFPNGIDGQAFYQKDVTGKVPDWVTLFPYHSKDDKEQKNFMVCTEEAGLLLMA
NMGCIEINPWSSTVNKPDNPTWCIIDLDPGKNTPFDKVIEAANVTHQLLDAAGIPSYCKT
SGSTGMHIYIPLGAKYTYEQSKEFARVIVTLVQAQIPAFTSIERQISARKGKLYLDFLQN
RPQATLAAPYSVRPRPKASVSMPLHWEEVKKGLKVTDFTIANAIARIQAEGDLFKPVLGK
GISLTKALKQLEVL
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgagccttgccagatataagcaaaagcgcagcttttcgcacacaccagaacccgctgga
ggtaaagccagcagtggccgccttcgttttgtgatccagaaacatgatgcttctcatttg
cactacgatttccggctggaaatggatggcgtattaaaaagctgggcagtgcctaaaggg
ccttctacagacccttctgtaaaacgcctggctatgatggtagaagatcacccttacgat
taccgcacttttgaaggaattataccggaaggtaattatggtgcaggaacggtgattgta
tgggatgaaggtacctatgagccattagaacaggcgaaaacaaagaaagaacaggaaaag
ttgctgttgaagcaattgaatgccggctcgctcaagtttgccctgcatggtaaaaagctg
aaaggagaatttgctttagtacatacgcatggaaggggagaaaactcctggttgctgatt
aagcaccgtgataaatatgccgctactactgatattaccaaaaaggataaatcggttgtt
tcaggcaaaacattggcaaaagtagaagctaccagcacccatatctatggggaagatcat
aaagagcctgatactgcggggaaagtaaaggtgcctgtgaagaaggttgccgcaaataaa
acagccgctaaaacagcctttaaaaagacggccgctaaaaaagcagttaagcctaaatcc
gccaccacccaggccgttaaaaaaaaagccccagccacacagggcgtaaaaaaagccttt
cctaaaaatagtagccctatgctggcaaccctggtagataaaccatttgatgaagaaggc
tggctatacgaaattaaatgggatggttaccgggcattgacgttaaagcatgggaaatct
actgaactggtttcgcgcaatcagaaatcgtttaatgaaaaattctatccaatatatgaa
gccgtaaagcaatggaaggtggatgctgtagtagatggagaaattgtggtagtgaataaa
aacggggtatctaatttcggtttgttgcaaaactggcgcagtgaagccgatggcgatttg
tattactatgtatttgaccttctctggttgaatggatatgatgtaacctccttgcctttg
cagcagcgtcgccagttgttgaaagagcaattaccttccccggatggacctatcaggatg
agtgaaaactttaatgctactgctaccgaatttctggctgctgctgctgaaaccggcctg
gagggtattatcgctaaaaaagaaaatagtaaatatgaacctggtaaccggtcgcgcaac
tggcttaaaatgaaaacgggtaaaaggcatgaagtggtaataggtggctttacgcaaaat
aagggttctgtgaagttgttcagttcgctattggtaggtgtatatgaaaatggaaaactg
caatacaccggtaaaataggcaccggctttacagaagcgatgcaaaaagatatgatgaag
cagtttaagccccttattaccagcaagcttccttttgaacaggaaccggatgtaaataaa
ccttcccgcttccggcccgatccacctcatgccagcgttacatggttacggcctaagctg
gtatgtgaagtaagctataccgaaataaccagtgatggcgtaatgcggcatccttctttt
gaaggcatgcgggaggataaaaaagcaaaagacgtaaaacgcgaaatagccgttcccgtg
aaaacagtgaaagaaaacaaaagcgccctgcacaccagcaaggtgctacagccagctggc
aaaacagcacgtaaaaccctgttgaatccgactgatgaaagccaggtgcggaaggtgaat
gggcaggagttgagctttaccaacctggataaaatatactggcccaaagacaagatctct
aaaagagacatgctgaattattactaccaggtagcgccttatatcttgccctatatcaaa
aacagacctcaatcgttgaaccggtttccgaatggcattgacggtcaggcattttaccag
aaagatgtaacgggtaaggtgccggattgggtaaccctgtttccttatcatagcaaggat
gacaaagagcagaaaaactttatggtatgtacagaggaagccggactgttgttaatggcc
aatatgggctgcattgaaatcaatccctggagcagtaccgtgaacaagccggacaatcct
acctggtgcatcatcgacttagatcccggtaagaatacaccgtttgataaggtgatagaa
gcggccaatgtaacacatcagttactggatgcggcaggtattccttcttattgcaaaacc
tccggctctacaggtatgcatatctatattccgttaggagcgaaatatacctatgagcaa
tcgaaagagtttgcccgggtgattgtgaccctggtgcaggcgcagatacccgctttcacc
agtatagagcggcagataagtgcccgtaagggaaagttatacctcgactttttacaaaac
cgcccgcaggccaccctggctgctccttattcggtaaggcccaggcctaaggcttcggtg
tccatgcccttgcattgggaagaggtgaaaaagggattgaaggttaccgactttactatt
gccaatgccatagccaggatacaggccgaaggcgacctgtttaagccggtattgggcaaa
ggcattagcctgactaaagcattgaagcaactggaagtgctctaa

DBGET integrated database retrieval system