KEGG   Candidatus Fluviicola riflensis: CHH17_17620Help
Entry
CHH17_17620       CDS       T05019                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
flu  Candidatus Fluviicola riflensis
Pathway
flu00010  Glycolysis / Gluconeogenesis
flu00053  Ascorbate and aldarate metabolism
flu00071  Fatty acid degradation
flu00280  Valine, leucine and isoleucine degradation
flu00310  Lysine degradation
flu00330  Arginine and proline metabolism
flu00340  Histidine metabolism
flu00380  Tryptophan metabolism
flu00410  beta-Alanine metabolism
flu00561  Glycerolipid metabolism
flu00620  Pyruvate metabolism
flu00625  Chloroalkane and chloroalkene degradation
flu01100  Metabolic pathways
flu01110  Biosynthesis of secondary metabolites
flu01120  Microbial metabolism in diverse environments
flu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:flu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHH17_17620
   00053 Ascorbate and aldarate metabolism
    CHH17_17620
   00620 Pyruvate metabolism
    CHH17_17620
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CHH17_17620
   00561 Glycerolipid metabolism
    CHH17_17620
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CHH17_17620
   00310 Lysine degradation
    CHH17_17620
   00330 Arginine and proline metabolism
    CHH17_17620
   00340 Histidine metabolism
    CHH17_17620
   00380 Tryptophan metabolism
    CHH17_17620
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CHH17_17620
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CHH17_17620
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CHH17_17620
Enzymes [BR:flu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CHH17_17620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ASS50512
LinkDB All DBs
Position
complement(4090117..4091673)
Genome map
AA seq 518 aa AA seqDB search
MSVTATTPGIQETLKTLGIEAINRGASTGGHWFNTRGPQIDSISPVDGQLIASVHAATEA
EYEAIIMKAQEAFKVWRTIPAPKRGEVVRQLAEKIREYKQPLGELVSFEMGKSLQEGLGE
VQEMIDICDFAVGLSRQLYGLTMHSERPSHRMYEQYHPIGIVGIISAFNFPVAVWNWNTA
LAWVCGDVCVWKPSEKTPLTAIACQKITQEVFAANDVPEGVSCLLIGDAEIGKLMSNDVR
VPLVSATGSTRMGKAVSQAVGARLGKSLLELGGNNAIIIAPSADLKMVVPGAVFGAVGTA
GQRCTSTRRLIIHEEVYDKVRDAIVKAYGQLKIGNPLDQNNHVGPLIDKDAVTAYENALK
QVVAEGGKVIVEGGVLSGEGYESGCYVKPAIAEAENHFQIVQHETFAPVLYLMKYSGGVE
NAIALQNGVPQGLSSAIMTNNLREAEAFLAATGSDCGIANVNIGTSGAEIGGAFGGEKET
GGGRESGSDAWKVYMRRQTNTINYSDSLPLAQGIKFDL
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtcacagctacaactcctggaattcaggaaacgctcaaaaccctcggaatagaa
gctattaaccgcggggcatctacaggaggtcattggtttaatacccgtggtccgcaaatc
gattcaatttctccggtcgatggccagttaattgcctctgtgcatgccgcaacggaagcc
gaatacgaagccatcatcatgaaagcacaggaagcattcaaagtgtggcgtacgattccg
gctccgaaacgtggagaagttgttcgtcagctggctgaaaaaatacgtgaatacaaacaa
ccgctcggtgagttggtttctttcgaaatggggaaatcactgcaggaaggtttgggtgaa
gtacaggaaatgatcgatatctgcgatttcgcagttggactttcccgtcaattgtacggt
ttaactatgcactcggaacgtccgagccaccgcatgtacgagcaataccacccgatcgga
attgtaggaattatttctgcattcaatttcccggttgccgtttggaattggaacacagct
cttgcatgggtttgtggtgatgtttgtgtttggaaaccgtctgaaaaaacacctttgact
gctattgcctgtcagaaaatcacgcaggaagtgtttgcagcaaatgatgtgcctgaaggt
gtttcatgtttgctgatcggtgatgccgaaatcgggaaactgatgtcgaatgacgttcgc
gttcccttggtatccgctacaggttctacccgtatggggaaagccgtttcccaagctgtt
ggtgcccgtttgggtaaatcattgttggaattgggtggaaacaacgcgatcatcatcgct
ccatccgctgatttgaaaatggtagtaccaggtgcggttttcggtgctgtcggaacagcc
ggacaacgttgtacatctacacgtcgtttgatcatccacgaagaagtttatgataaagtg
cgcgatgcaattgtaaaggcatacggacaattgaaaataggaaatccattggaccaaaat
aaccacgttggcccgctaatcgataaagatgctgtaacagcttacgaaaacgccttgaag
caagtggttgccgaaggtggtaaagtaattgtggaaggtggtgtattgagtggtgaaggt
tacgaatccggttgctacgtgaaacccgcaattgcagaagcggaaaaccatttccagatc
gtgcagcatgaaacgtttgccccggtattgtacctgatgaaatattccggtggcgtagaa
aacgcgattgcattgcaaaacggtgttccacaaggattgtcttcagcaattatgaccaac
aacttacgtgaagcagaagcattcttggctgcaactggttcagattgcggaattgctaat
gtcaacattggtacttcaggtgctgagataggtggtgcatttggtggcgaaaaagaaact
ggcggtggccgcgaatcaggctctgatgcctggaaagtgtacatgcgtcgtcagacaaat
acgatcaactactccgattcattgccattggcgcaaggaatcaagtttgatttataa

DBGET integrated database retrieval system