KEGG   Finegoldia magna: FMG_1049Help
Entry
FMG_1049          CDS       T00661                                 

Definition
(GenBank) transcriptional regulator MarR family
  KO
K23775  MarR family transcriptional regulator, organic hydroperoxide resistance regulator
Organism
fma  Finegoldia magna
Brite
KEGG Orthology (KO) [BR:fma00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fma03000]
    FMG_1049
Transcription factors [BR:fma03000]
 Prokaryotic type
  Helix-turn-helix
   MarR family
    FMG_1049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_27 HTH_24 HTH_34 HTH_20 TrmB Penicillinase_R Mga
Motif
Other DBs
NCBI-ProteinID: BAG08467
UniProt: B0S277
LinkDB All DBs
Position
complement(1138354..1138803)
Genome map
AA seq 149 aa AA seqDB search
MDQDYKEYMKLDKQLCFQLYAASRIVTNTYSKFLKPLGLTYTQYIVFLVLWEKDGITVGQ
LCDKLYLDNGTITPIIKKMQSQGYLERVRSSKDDRIVMIYLTDEGKKLQEKAKEVPKLVS
ECAYISDDKKVQMNNILQEFFDNYNKTKK
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggatcaagattacaaagaatatatgaagttagataaacaactctgttttcaactttat
gccgcatcacgtatagtaacaaatacatactcaaaatttttgaaacctttaggattaact
tacactcaatatattgtgtttttagttctttgggaaaaagatgggattacagtggggcaa
ttgtgcgataaattatacttggataatggtactattactcctataataaaaaagatgcaa
tcccaaggctaccttgaaagagtgcgtagttcaaaagatgataggattgtaatgatttac
ttgacagatgaagggaaaaaattacaagaaaaagcaaaagaagtacctaagttagtttct
gagtgtgcatatatttctgatgataaaaaagttcaaatgaataatatattacaagagttt
tttgataattataataaaacaaaaaaataa

DBGET integrated database retrieval system