KEGG   Fomitiporia mediterranea: FOMMEDRAFT_100638Help
Entry
FOMMEDRAFT_100638 CDS       T03132                                 

Definition
(RefSeq) DNA ligase 4
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
fme  Fomitiporia mediterranea
Pathway
fme03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:fme00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    FOMMEDRAFT_100638
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:fme03400]
    FOMMEDRAFT_100638
Enzymes [BR:fme01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     FOMMEDRAFT_100638
DNA repair and recombination proteins [BR:fme03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     FOMMEDRAFT_100638
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT_2 DNA_ligase_A_C RNA_ligase BRCT LIG3_BRCT PTCB-BRCT
Motif
Other DBs
NCBI-GeneID: 18669761
NCBI-ProteinID: XP_007261368
JGI: Fomme1_100638
LinkDB All DBs
Position
Unknown
AA seq 1029 aa AA seqDB search
MQATPPPTEVSPDEEEVPSHHEPVTESQQQIVYPPAPQNVRSPPFPILAELFDNLANERR
QDLRRKRLANWFNGWRRDAGKDLYPVLRLILPQKDRERSVYGLKEKNLAKTYIKLIPLGM
KDPDAVRLLNWKRPTERDKTSGDFPTVLYEVVSKRSSVTQGSLTVDQVNDILDQLSQSIG
KQDLQSKLLQRIYNSCTPEEQRWVARIILKDMQINVKETTVFAVFHPDAVDLFNACSDLK
KVAHELWDPERRLNDSDKQVNLFRAFAPMLCKRPSAKLEDSIKDMQGQPFIIEEKLDGER
MQLHKRGNEFFYCSRKGKDYTYLYGANSESGSLTPYIWNAFDERVDEIILDGEMLVWDPV
SGRNLPFGTLKTAALDKSKTMANPRPCFKVFDLLYLNGMCLTKRSVKFRKRNLKAYVKEV
KGRLEYVTEYEGRSASDVRKRLEEIMANRGEGLIIKHPNSEYILNGRNKDWVKVKPEYMD
NMGETVDLLVVGGNYGTGYRSGGVSTLICAVLDDRRTASDDDEPKYSSFVRIGTGLSYAD
YVWIRQKNWKPFDKNKMPSWYQASKKGYDDKGDIYIEPEDSFILKIKAAEITPSDQYHLG
FTMRFPRAVAIRDDLSIADCMSATAVLESMKTVKKRKIEETDLKTKKKRKVVRKPVNVMP
EYRGEVLKDVDVQSDIFEGLKFMVASDPRNRNGDKEKKELQKIIHVNGGKYVQIAKGIDP
ILVVYGGLTIPYDLKLIIDKDIHDIIRPSWIYDCVERGKRLPLHKKYFFHATSDRKLDKE
FNEVGEGNTEPSTNGAPAPTAEAANEEESATESSGGEEPPTVKSTEIDPAMADWFKVDKK
SDGASSKEVPSDSETDPDSDYDELRFDEEAEEWVLPVRPAATMEDGQQRTPSTLRESSDD
VDNSDVRMGEDESAMELDPELIFKHLCFYLDTPTNAERHGMEIKSKYKDQISTSFVEIED
LIVANGGRVVSNLDEQKLTHVVLDKRDISRRKELMQRTSKPKHRYLVLSDFIHACVEEHS
LLDEEGFVP
NT seq 3090 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgacgcctccaccaacagaagtcagtccggatgaggaagaagtaccatcgcac
catgaacctgtcacagaatcccagcagcaaattgtctatccccctgcacctcagaacgtc
aggagcccaccgttccctattcttgcagaactttttgacaatcttgcaaatgagcggagg
caagacttgagaagaaagcgtctggcgaattggttcaatggctggcgacgcgacgccgga
aaggacctttatcccgtcttgcgtctgattcttccacagaaagaccgcgagcggtctgtc
tatggactgaaggagaagaatctcgccaagacatatatcaaactcataccactcggaatg
aaagacccggacgctgtcaggctgctcaattggaagagaccgaccgaaagagataaaacg
tcgggagattttccgaccgtattatatgaagttgtcagcaaacggtcttccgtaactcaa
ggcagtttgacggtcgatcaggtcaacgatatactggatcagttaagccagagcattgga
aagcaggacttgcagtccaaacttctccagagaatttacaactcatgtacacccgaagaa
cagcgatgggtagcacggatcatcctaaaagatatgcagataaatgtcaaagaaaccacc
gtctttgctgtattccatcctgacgctgtcgatctatttaatgcctgctcggatttgaag
aaggtcgctcatgagctttgggatccagaacgcagactgaatgattcagacaaacaagtc
aacctattccgcgctttcgccccgatgttgtgcaagcggccaagcgcaaagctcgaagac
tctatcaaagatatgcaaggacaaccgttcattattgaagagaagctagatggagagaga
atgcagttgcataaacgggggaacgagttcttttattgttcgagaaaaggaaaggattac
acgtatctttatggcgccaattcggaatcaggaagtctgacaccatacatatggaatgca
tttgacgagcgagttgacgagatcatacttgatggcgaaatgttggtctgggatcctgtt
tctggacgaaatctcccatttggaactttgaagactgcagcgctagacaagtcgaagacc
atggccaatccaagaccgtgcttcaaagttttcgatctactatatcttaatggcatgtgc
ttgaccaaacgttccgtgaagtttcgcaagcgcaatttgaaagcatacgtgaaagaagtc
aagggcagactcgagtatgtcactgaatatgaaggcagaagcgctagtgacgttcgaaaa
cgcctcgaagaaatcatggcaaatagaggggagggactcattattaagcaccctaattcc
gagtacattttgaacgggagaaataaggattgggtaaaagtcaaacccgagtacatggac
aatatgggagagactgttgatctacttgttgtcggggggaattatggaactgggtaccgt
agcggcggagtctcaacgcttatatgcgcggttctggatgacagaagaactgcgtcggat
gatgacgaaccgaagtacagttcattcgtgcgaattggtaccggtttatcatatgcggac
tatgtctggatccgtcagaaaaattggaaacctttcgacaagaacaagatgccctcatgg
taccaagcgtcgaagaaaggttatgatgataagggcgatatatatattgaaccagaagat
tctttcatcttgaagatcaaagccgctgaaatcactccgagcgaccagtaccatctcggc
tttactatgcgctttcctcgcgccgttgctatccgtgatgatctgagtatagctgactgt
atgtcagcaacggccgtactcgagagcatgaagaccgtgaagaaacggaagattgaagaa
actgacttgaaaacaaagaagaaacggaaggttgtacggaagccagtaaatgtcatgcca
gagtaccgaggcgaggtgttgaaggatgtcgatgttcagtcagatatctttgagggattg
aaattcatggtcgcttccgaccccagaaacaggaatggtgacaaggagaagaaggagctc
cagaagatcatccacgtaaacggtggtaaatatgtgcagattgcgaaggggattgatcca
attcttgtggtttatggcggccttacaataccttatgacttgaaacttatcattgataag
gacatccacgacatcattcggccttcttggatttacgattgtgtcgagcgagggaagcga
ctacctttacataagaaatatttcttccacgctacctcggaccggaagcttgacaaagag
ttcaacgaagtcggtgaaggaaacacagagccaagtacaaacggtgctccggctcctacc
gcagaagcagcgaatgaagaagaatcagctacagaaagttctggaggtgaagaacccccg
actgtcaagtccacggaaatcgatcccgccatggcagattggttcaaagtggataagaag
tcggatggtgcatcatcgaaggaggtaccaagcgactcggagacggaccctgactctgat
tatgatgagttgaggtttgacgaggaggcagaggaatgggtcttgcctgttagaccagct
gcgacgatggaggatgggcagcaaaggacaccttcgaccttgcgagaaagcagcgacgat
gtcgacaactccgatgtaagaatgggagaagacgagtcagccatggaactcgacccagag
ctcatcttcaagcacctctgcttctacctcgacacacccacaaatgcagaacgccacgga
atggaaattaagtcgaagtacaaggatcaaatctccacttcgttcgtcgagatcgaagac
ctcatagtcgcaaacggcggccgggtcgtctccaatctggacgaacagaagttgacacat
gtcgtacttgataaacgagatatcagtcgacgtaaggagcttatgcagcggacgtcaaaa
ccaaaacatcgatacctcgtgttaagcgatttcatacacgcatgcgtcgaggagcatagt
ctgcttgacgaagaagggttcgttccttga

DBGET integrated database retrieval system