KEGG   Fomitiporia mediterranea: FOMMEDRAFT_101793Help
Entry
FOMMEDRAFT_101793 CDS       T03132                                 

Definition
(RefSeq) heme peroxidase
Organism
fme  Fomitiporia mediterranea
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 18669842
NCBI-ProteinID: XP_007262335
JGI: Fomme1_101793
LinkDB All DBs
Position
Unknown
AA seq 1143 aa AA seqDB search
MSAFVAAIATRVSDSADAVARSVAPVDTDGAGTLADVLHKSAQDVAIFAERGPGFRLRDI
PAYIDAIKNINGGEGMDDRKMFLEKVLVLMSRLPDDSEFAKSLQVFVIDTLYKDLPHPPA
AYIPTLSAGGGAHSYPSTSAASYANVNSHANGHANGSAHHDSESHARRPYSDPSYNARRP
YAARSADGTGYSTVYPDMGAARKPYARTVPSTHAYSRWPDAGLVFDALLARQPSGTTNGI
LPSSNPDAIPGHTTLPPTNNRGFAPQPGGLSSLFFAFADLVIHSCFNTSHSDWGINNVSS
YLDLSPLYGSSDADLQKVRRFDGTGRLWEDVFADARVLFMPPSVPALLVLFCRNHNFIAS
KLLAINESGTFKSGEALADLSDEDRKAQDDELFARARLVNCGWFMRVILGDYVGAILGLV
RDGLEWRLDPLAESREPDHSVSPRGEGNVVSLEFNLLYRWHAAISERDTAWTEHAFEEYF
ETTDFKSITIEQFERTLAQKLRPDPDVRKWTFDNVDNQPLARDPSTGGFNDGDLAALIQA
ATAAPAGAFKARGIPEVLRVVEIMGIEQARQWGTATMNEFRQFMGLKPFSSFEEWNSDPE
IHKTAEMLYGDIDNLELHVGLQAEEAKPPIPGAGLCPGYTISRAILSDAVALVRGDRFLT
TDFTVYNLTSWGYLDCFPQKYDGAYGGVLTRLLYRTLPEYYPARSTYARFPFMVPSEMRG
YLFKLVNSPVRNYEFAPPKPPAPVVVLRDYKNVKVVLARPDEYKSDAKQKIVELTSDTTL
DIHLVNKTLNFFIERRNYPSIFEHIAGKLIEEKSISCPGSRNVKYIDVVRDVINLVPVYF
VATELMGLPIKTDDTPRGLFRDTEFAAMFMDVCNFVFINTDGYMDWVLRERSTRSTRKVT
ENLSEHLKRLSQRSIVGKLADSVLQWYTGEDNFSDTFLAKVLSSTMHDRRTLVNSLFGAL
IPSISLFSKSISHILDFFLQDEQADVRRDLVALCNTGSARADKEVYQLACEALRLNPPVL
SLMRKESNPGGEPAKVYLSIVEANLDPTAFGDNPSSLDYRHLPGQALLGLEEYGLTNSTF
FESIVPRVLRAIFTLKNVQRATGPMGTLNRIVETERGCPEVEYLDEKSEITPFPVSMVIQ
YEV
NT seq 3432 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcatttgtcgctgcaattgcgacgcgcgtgtccgactcggcagatgctgtcgct
cgctcagttgcgccagtcgatacagacggtgccggaactctggcagacgtcctccacaag
agtgcacaagatgttgctatctttgctgaacgtggtccaggctttcgcctgagagacatt
cctgcttatattgatgcaatcaaaaatatcaatggcggagagggcatggacgaccgaaag
atgtttctcgagaaggtcctcgttttgatgtcgcgcctgccggacgacagtgaattcgcg
aagtcactccaagtttttgtcatcgacacgctatacaaagacctccctcatccacctgct
gcatacattccgacactgtctgctggtgggggtgcacactcgtatccatccacaagtgct
gcaagttatgctaatgtgaacagtcatgccaatggacatgcaaatgggtctgcccaccat
gactcagagtcccacgcacgccgtccttactcggacccatcttacaacgcacgacggcca
tatgctgcacgaagcgccgatggcaccggctatagcacagtgtatcctgatatgggagca
gcgcgcaagccgtatgcccgaaccgtaccttcgacgcatgcgtattcgcgctggccggac
gctggtctcgtattcgatgcgcttttggcgcggcagccctccggtacgactaacggcatc
ttgccttcgtcaaatccagacgcgattcctggacatacgacgcttccaccaacgaacaac
agagggtttgcacctcaacccggcggactcagttcgttgtttttcgcattcgctgatctt
gttatccattcgtgtttcaacacaagccattctgactggggcatcaataacgtatcttcc
tatctcgacttgagccctctatacggtagcagcgatgcagacttgcaaaaagtaaggcga
ttcgacggaacaggtaggctatgggaggatgtatttgcggacgcaagggtgctctttatg
cctccaagcgtaccagctctactcgtcttattttgcaggaatcataatttcatcgcttca
aaactcctggcaatcaacgaatcaggcacgttcaaatctggcgaagcgcttgcagacctg
agcgacgaggatagaaaggcccaagatgatgaactttttgcacgtgccagactcgtaaac
tgcggctggtttatgcgtgttatcctgggcgactatgtcggtgctattttaggactggtg
agggatggcttggaatggcgcttggacccattggctgagtcgcgtgagccagaccattct
gtgagccctcggggtgaaggcaatgttgtgtccctcgaattcaaccttctttaccgttgg
catgctgcaatcagtgaacgcgacacggcttggacagagcatgcattcgaagagtacttc
gagactacagacttcaaatctattacgatagaacagtttgagcgtactttggcacaaaag
cttcgccccgatccggatgtaagaaagtggacgttcgataacgtggacaatcaacctctt
gctcgtgatccatccacgggtggctttaatgatggagacctcgctgccctcatacaggca
gcgacagcagcacctgctggcgcgtttaaggcacgcggtatacccgaagtcctccgcgtg
gtggagataatgggtattgagcaagcgcgccaatggggaaccgctacgatgaatgagttt
aggcaatttatgggactgaagccgttttcgagctttgaagaatggaactcggacccagaa
atacataaaactgcggagatgctctacggcgatattgataatctcgaacttcatgttggt
ctccaagcagaggaggcgaagcctcctattcctggggcagggctttgtcctggctataca
atctctcgtgccatcctttcggacgccgttgctctcgtcagaggcgatagattccttacg
accgacttcaccgtctacaacctaacgtcgtggggctacttagattgcttcccacagaag
tatgacggtgcatacggcggtgtactcacgcgtctgctataccgcactcttccagaatat
tatcctgctcggtcgacgtatgcgcgtttcccattcatggttcctagcgaaatgcgtgga
taccttttcaagctcgtcaatagtccggttagaaattatgaatttgcacctccaaagcct
ccggctcccgtagttgtgctgagggattacaagaatgtgaaagtggtcttagcgagacca
gacgaatacaaatccgacgcgaagcagaagatagttgagttgaccagtgacactacgctc
gacattcacctcgtcaacaaaacgctcaatttcttcatcgaaaggagaaactatccctct
atctttgaacacattgcaggcaagctcatcgaggaaaaatccatctcgtgccccggttcg
agaaacgtcaagtatattgacgttgttcgggacgtcattaaccttgtaccagtctacttt
gtcgcgacagaactcatgggcctgccgattaagactgacgacacgccacgcggtctattc
cgtgatacggaatttgcggctatgttcatggacgtttgcaactttgttttcataaacaca
gatgggtacatggactgggtgttacgcgagaggtcgacaaggtctactcggaaggtcact
gagaatttgagcgaacacctaaagaggctttcgcaaaggagcatcgtgggcaaacttgca
gactctgttctgcagtggtataccggcgaagacaattttagcgacacgttcctcgccaaa
gttcttagtagcacaatgcacgataggagaacactcgtgaacagcttattcggagctctt
attccttcaatctcgctgttctcgaagtcaatttcgcatattctggactttttcctgcag
gacgagcaggcggacgtccggagagatctagtagccttgtgcaacactggctcagcaagg
gctgataaggaggtataccaacttgcatgtgaagcactccgtctcaatcccccagtgttg
agtctgatgaggaaagagagtaaccctggcggcgaaccagctaaagtgtaccttagtatt
gtggaagcgaatctcgacccgacggcttttggagacaaccctagctctcttgattataga
cacctcccagggcaagccctcctcggtctggaggagtacggacttacaaattcgacgttc
tttgagtcgatcgttccaagggttctccgcgctatcttcaccttgaagaatgtccagagg
gcaacagggcccatgggcacgcttaacaggatcgtcgagactgagcgtggctgtcctgaa
gtcgagtacttggatgagaagagtgagatcacgccattccctgtgtctatggttattcag
tacgaagtgtga

DBGET integrated database retrieval system