KEGG   Fomitiporia mediterranea: FOMMEDRAFT_104563Help
Entry
FOMMEDRAFT_104563 CDS       T03132                                 

Definition
(RefSeq) succinate dehydrogenase
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
fme  Fomitiporia mediterranea
Pathway
fme00020  Citrate cycle (TCA cycle)
fme00190  Oxidative phosphorylation
fme01100  Metabolic pathways
fme01110  Biosynthesis of secondary metabolites
fme01130  Biosynthesis of antibiotics
fme01200  Carbon metabolism
Module
fme_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fme_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
fme_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:fme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FOMMEDRAFT_104563
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    FOMMEDRAFT_104563
Enzymes [BR:fme01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     FOMMEDRAFT_104563
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 Lycopene_cycl DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 18670036
NCBI-ProteinID: XP_007264237
JGI: Fomme1_104563
LinkDB All DBs
Position
Unknown
AA seq 643 aa AA seqDB search
MLRKALARLPKRSQQHHRAFHSSPAALRVVATNPVRAQEVTSLAAEGKYPVFDHEYDAVV
VGAGGAGLRAAFGLAEAGFNTACITKLFPTRSHTVAAQGGVNAALGNMTEDDWRWHMYDT
VKGSDWLGDQDAIHYMCREAPRSVIELEHFGVPFSRTKEGKIYQRAFGGQSLKFGKGGQA
YRCAAAADRTGHAILHTLYGQSLRHNTNFFIEYFALDLIMQDGECVGVMAINMEDGTLHR
FRSHKTVLATGGYGRAYFSCTSAHTCSGDGNGMVVRAGLPLQDLEFVQFHPTGIYGAGCL
ITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTIEIREGRGVGPEKDHIYL
QLSHLPAEVLHERLPGISETAAIFSGVDVTKEPIPVLPTVHYNMGGIPTKYTGEVLTIDE
NGKDKVVPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRACAHHIKENLEPGKPHKQVD
ENAGMQSIEFLDKIRTSDGPIPTAKLRLDMQKAMQTDAAVFRTEETLAEGVDKVTQIYKD
YDKVGIKDRSMIWNSDLIETLELRNLQQCAIQTITAALARKESRGAHAREDFPERDDEKW
MKHTLTFQPDPSKPDVVIKYRNVIDKTLDENECKSVPPFKRVY
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcaaggcgctcgctcggcttccaaaacgctcgcagcagcatcatcgtgcattc
cattcgtcgcctgctgccctccgcgtcgttgcgacgaaccctgtgagagcgcaggaggtc
acttcattagcggcggagggaaagtatccagtattcgaccatgaatatgacgcagttgta
gtaggtgctggtggtgcaggcttacgagcagctttcggtcttgcagaggcaggcttcaac
acggcatgcatcacgaagttattcccgacgcgtagtcacaccgtcgcagcgcagggaggt
gttaacgccgctcttgggaacatgactgaggatgattggaggtggcatatgtatgatact
gtcaaaggatccgactggctcggtgaccaagatgccattcactatatgtgccgcgaagcg
ccaaggtcagtcatcgagctcgaacatttcggtgtgccgttctctcgaacgaaggagggc
aagatttaccaacgtgccttcggtggtcaatcactcaaattcggcaagggcggtcaagca
tatcgatgtgcagctgccgccgaccgaacaggacacgccatccttcacaccctttacgga
cagtccctccgtcacaacactaacttcttcatcgaatacttcgcacttgaccttatcatg
caagatggtgagtgcgtgggtgtaatggcaataaacatggaagacggcactttgcatcga
ttccgctcacataagaccgttctcgcgactggtggatacgggcgagcatacttcagctgc
acatcagcgcacacatgttcgggtgacggcaatggtatggtggtccgcgccggtttgcca
ctccaggatctcgaattcgttcaattccacccaacgggtatttacggtgctggatgtcta
atcaccgagggttctcgtggcgaaggcggatacctgcttaactccgagggtgaacggttc
atggagcgttacgcgccaaccgcgaaggaccttgcctctcgtgatgtcgtttctcgtagt
atgaccatcgaaattcgtgagggtcgtggtgttggacctgaaaaggaccatatttacctg
cagctaagccatttgcctgctgaggtccttcatgagcgcttgccaggcatttcggagact
gcggctatcttctctggtgttgacgtcactaaggagccgattcctgtattgccgacggtt
cattacaacatgggtggtattccgacaaagtacactggcgaggtcttgactatcgatgaa
aatggcaaagataaggtcgttcccggtctctacgccgctggcgaagccgcgtgtgtctca
gtacacggtgcaaaccgtctcggcgcaaactcgcttcttgacattgtcgtcttcggccga
gcatgcgcacatcacattaaggagaaccttgagccgggcaagccgcacaagcaggttgac
gaaaatgctggaatgcagtctatcgagttccttgataagattcgcacgtctgatggacca
atccctactgccaagttaagacttgacatgcaaaaggctatgcagaccgacgctgctgtg
ttcagaacggaagaaacgcttgctgaaggtgtcgataaggtcacgcagatctataaggac
tatgataaggtcggcattaaggataggagtatgatttggaattccgacttgattgagact
ctcgagctccgtaatctccaacaatgcgccatccaaactatcaccgctgccctcgctcgt
aaggagtcgcgcggtgcgcatgcacgcgaggacttccctgagcgcgacgacgagaaatgg
atgaaacacactctcaccttccaacctgacccatcaaagccagacgtagtgatcaagtac
cggaacgtcattgacaagacgctcgatgagaatgagtgcaagtctgtaccgccgttcaag
cgtgtgtattag

DBGET integrated database retrieval system