KEGG   Fomitiporia mediterranea: FOMMEDRAFT_107311Help
Entry
FOMMEDRAFT_107311 CDS       T03132                                 

Definition
(RefSeq) ubiquitin binding protein
  KO
K12182  hepatocyte growth factor-regulated tyrosine kinase substrate
Organism
fme  Fomitiporia mediterranea
Pathway
fme04144  Endocytosis
fme04145  Phagosome
Brite
KEGG Orthology (KO) [BR:fme00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    FOMMEDRAFT_107311
   04145 Phagosome
    FOMMEDRAFT_107311
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fme04131]
    FOMMEDRAFT_107311
Membrane trafficking [BR:fme04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    FOMMEDRAFT_107311
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VHS FYVE UIM FYVE_2 GAT Hrs_helical C1_1
Motif
Other DBs
NCBI-GeneID: 18670265
NCBI-ProteinID: XP_007266142
JGI: Fomme1_107311
LinkDB All DBs
Position
Unknown
AA seq 754 aa AA seqDB search
MSLTGWLWGTSQVDEAIDKATSELLPTGTEDIALNLEISDQIRSKAVPPKDAMRALKRRL
NHKNPNVQLLALSLTDTCVKNGGDHFLMEVASREFMDNLVSILKIPVLNLDVKNAILRYI
QNWAVAFEGKPNLSYVVQVYRALQSEGFTFPPKDISVTSSAMVDTQTAPEWIDSDVCLRC
RTPFSFTNRKHHCRNCGQVFDQQCSSKSLPLPHFGIQQEVRVCDSCHMKLTRSKLPKEDR
KHSRSFSTPRHRSGRELADEELQRAIQLSLEEVGAANVNGRNRRPGYTPSQPEPSNFGKW
QTSEPPLVDRKTRPQAADDDESDPDLRAAIEASLREANAPKPSAPISLETPRSEAPSFVP
SQSQSYPATSSTAVPPQSNYELAPLESDVILTFSQTVQEVEARGGRDISRYPAVNELYDK
ANGLRPKLALSLDDTDRKEKTLSDMHDKLSQAVKLYDKLLTEQLSRPSWRSSSQQESSRY
NTVDGSYGQWVSRQPGPATTQRYGEPSYGLPQASQSPPPVNVPYAPVRQSSYGSVSQPAQ
QYSPTPAPAQYYSSPPPAPTQLPQQPQPAPTTQYATYAQPILPTPVPMASSAQSPPLQPQ
VSSSAPYTAPTPVPSQPQPQAQYVQSPPPQPQPLSRQNTLSYVPPTPQPVYAQGHAHIPP
QAQAQQHQPAQPQIQAQYYQPPALQTQPQPQQPQPPAQAPPQPQAHYQPPLPQAQVQLPQ
FPVVPTSNPQTFSLYGPTPGLEQTERKEALLIDL
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atgtctctcaccggttggctgtggggaacaagccaggtcgacgaagcaatcgacaaggcg
acgtccgaactccttccgacgggcacagaggacattgcactaaatctcgagatatccgac
cagatacgctccaaggccgtgcctcccaaggatgccatgcgtgcactcaaacgacgcctc
aatcataagaacccgaatgtccagcttcttgctctgagtctgacagatacatgcgtaaag
aatggtggcgaccatttcctgatggaagtagcttcccgcgaattcatggacaaccttgtc
tccatcctcaagattcccgtactcaatctcgacgtgaagaacgcgatactcagatatata
cagaactgggctgttgctttcgaagggaagccaaatctatcgtacgttgtccaggtgtac
cgagccttgcagagcgaaggttttacgttccctccgaaagatatatctgttactagctca
gcaatggttgatacgcaaactgcgcctgaatggattgactcagatgtctgtttgcgatgt
cgaacaccgttctcgttcacaaaccgaaagcatcactgccggaactgcggtcaggtcttt
gaccaacaatgttcgtcaaagtcgcttcctcttcctcactttggtatccaacaagaagtc
cgggtgtgtgattcatgtcatatgaaactgaccaggagcaagctgccgaaggaggacaga
aagcacagccgaagcttctcgacgccgcgacatcgttctggtcgcgagctcgccgatgag
gagctccaacgtgcgatccagctttcacttgaagaagtcggggcggcaaacgtgaatgga
cgtaatagaagacctggatacactccgtcacagcccgaaccgtcaaattttggaaagtgg
caaacatcagaaccacctttagttgatcgtaaaacacgtccccaggcagcagatgatgac
gagagtgatccagacttacgagcggcaattgaagcgtctttacgggaggccaatgcgccc
aaaccaagcgcgcctatatccctcgaaactcctcgctcggaagcgccatcttttgtgcca
tcgcaatcgcagtcataccccgcaacttccagtacagctgtgccacctcaatcaaactac
gaactagcacctcttgaaagtgacgtgatcttaacgtttagtcagacagtgcaggaagtc
gaggcgcgaggaggacgtgacatttctcgttatcctgctgtgaacgaattgtacgacaag
gcaaacgggctccgacccaaactggctctttcgctggatgatacagataggaaagaaaag
acactaagcgacatgcacgacaagctctcacaagccgtcaagctgtacgataagctcctt
accgagcaattatcacgaccatcttggcgatcctcgtcgcagcaagagtcatccaggtac
aacactgtggacgggtcttacggccagtgggtgtctagacaaccaggtccagcaacaacg
caacgatatggcgaaccctcgtatggtctaccgcaggcctcgcagtctccaccaccggtt
aatgttccctacgcgcccgttcggcaatcttcgtacggttctgtttctcagcctgcgcaa
caatactcgcctactccagccccggctcagtattactcgtctccccctcccgcgccaacg
cagttaccgcaacagcctcagcctgctcccacgacgcagtatgctacttatgcacagccc
atacttccaactcccgttccaatggcatcgtcagctcagtctccacctctacagcctcaa
gtgtcctcgtccgctccttataccgcgcccactcccgttccttcacaaccgcagcctcaa
gcccagtatgtccagtctccaccaccacaacctcagcctctctcgcgccagaacacgcta
tcgtacgttccacccacacctcagcctgtatatgcgcagggacatgcgcatatacctcct
caagcgcaggctcagcagcatcaaccggcccagccccaaatacaggcgcagtattaccag
cccccggctttgcagactcagccacaacctcaacaacctcagcctccggcccaggcacca
ccgcaaccgcaagctcattaccagcctcctctgcctcaagcgcaagtccagctacctcag
ttcccggtcgtgccgacgtcgaatcctcaaacgttttccctgtacgggccaactccgggt
ttggaacagactgagaggaaggaggcgttgttgattgatttgtag

DBGET integrated database retrieval system