KEGG   Fomitiporia mediterranea: FOMMEDRAFT_109275Help
Entry
FOMMEDRAFT_109275 CDS       T03132                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
fme  Fomitiporia mediterranea
Pathway
fme00250  Alanine, aspartate and glutamate metabolism
fme00410  beta-Alanine metabolism
fme00430  Taurine and hypotaurine metabolism
fme00650  Butanoate metabolism
fme01100  Metabolic pathways
fme01110  Biosynthesis of secondary metabolites
Module
fme_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:fme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    FOMMEDRAFT_109275
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FOMMEDRAFT_109275
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FOMMEDRAFT_109275
   00430 Taurine and hypotaurine metabolism
    FOMMEDRAFT_109275
Enzymes [BR:fme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     FOMMEDRAFT_109275
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 18670406
NCBI-ProteinID: XP_007267523
JGI: Fomme1_109275
LinkDB All DBs
Position
Unknown
AA seq 545 aa AA seqDB search
MALARHVNPDKLLQDARDHKAKNHAHHLTNTDPTSSVSAYGARYGTYPLPKYKIPSKGTD
AEATYQLVHDELSLDGSPLLNLASFVHTWMPAPADKLMQENMNKNLIDQDEYPMTQMIHE
RCVSMLADLWNAPNGKQAIGTATTGSSEAIQLGGLAMKRIWQEKRKAAGKSIHEPGPNIV
MGANAQVALEKFARYFEVECRLVPISEESKYRLDPKRAMEYVDENTIGVFVILGSTYTGH
YEPVKEMSDLLDEYEKKTSHHVPIHVDAASGGFVAPFATPKLAWDFRLPRVVSINTSGHK
FGLAYVGVGWVIWRDKAHLPKDLIFELHYLGSIEYSFSLNFSRPAAPIIAQYFNFVHLGF
EGYRRIALADLKNARVLSRALEKSGYYHVLSDVHRFADGGSSVIEGAKQAAGVKNEEDVE
NYIPCLPVISFRFSDQFKSKYPNIQQKWMQTLLRSKGWIVPNYELAPNLQNVDILRVVVR
ENFSEALVDRLVTDIIELTEGLMKDDSPVHALSTLGATHSSARRGNGKLDEDSGPKSSGT
YAKQC
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggcacttgcaaggcacgtcaaccctgacaagcttctccaggacgcgagggaccacaag
gctaagaaccatgcccatcacctcactaatacggacccaacctcctccgtttcggcctat
ggagcgcgttatgggacttacccgctgccgaagtacaagatcccgtcaaagggcacggac
gcagaggcaacatatcagcttgtacatgatgagctttcacttgatggctctccacttctc
aacctcgcttcattcgtgcatacatggatgcccgctcctgcagataagcttatgcaagag
aacatgaacaagaacttgattgaccaggatgagtaccctatgacgcagatgatccatgaa
cgctgtgtctccatgctcgcggatctttggaatgctccgaacggtaagcaggctattgga
acagctacgacaggttcctccgaggctattcaacttggtgggcttgccatgaagcgcatc
tggcaagagaaacgcaaggctgctggtaaaagtatccatgagcccggacccaatattgtc
atgggcgcaaatgcgcaggttgctcttgagaaattcgctcgttatttcgaggttgagtgt
cgcttggttccgatctccgaggagagcaagtataggctggacccgaagagggccatggag
tacgtcgacgagaatacgattggcgtgttcgtcatccttggaagtacatacactggtcac
tatgaacccgtcaaagagatgtccgatcttctcgatgagtatgagaagaaaaccagccat
catgtccctattcacgtggatgcagcttctggaggattcgtcgcaccgtttgcaactccc
aagctagcctgggatttccgtcttccgcgggttgtctccataaacacgtctggacataag
tttggactcgcatatgttggtgttggttgggtaatctggcgtgacaaggcgcaccttccg
aaggacctcattttcgagctgcactatttggggtccatcgagtacagtttctcgctcaac
ttctcgcgcccggctgcacccattatcgcccagtacttcaactttgtacatctcggtttt
gagggttatcgccgtattgcgctggcagacctgaagaatgcccgtgtactgagtcgtgcg
ctcgaaaagagtggatattaccatgttttgagcgatgtgcatcgctttgcggacggcggt
tcgagcgtgatcgaaggtgcaaaacaagctgcgggagtcaagaatgaagaggatgttgag
aattatattccgtgcctcccagtaatctcgttccgcttttctgaccagttcaaatccaag
tacccgaacatccaacagaagtggatgcagacgcttctccgttcgaagggatggattgta
ccaaattatgaactcgcacctaatctgcaaaacgtcgacatccttcgtgtcgttgtgcgg
gagaacttctcggaagcacttgtcgaccgcttggtcactgacattatagagcttactgag
ggtctcatgaaggacgactctccggtgcacgcgctcagcacacttggcgcgactcacagt
tccgctcgtcgtggcaatggcaaactcgatgaagactcgggacccaagagctctggcacg
tacgcaaagcagtgctaa

DBGET integrated database retrieval system