KEGG   Fomitiporia mediterranea: FOMMEDRAFT_110692Help
Entry
FOMMEDRAFT_110692 CDS       T03132                                 

Definition
(RefSeq) Arginase/deacetylase
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
fme  Fomitiporia mediterranea
Brite
KEGG Orthology (KO) [BR:fme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fme03036]
    FOMMEDRAFT_110692
Enzymes [BR:fme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     FOMMEDRAFT_110692
Chromosome and associated proteins [BR:fme03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     FOMMEDRAFT_110692
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 18670521
NCBI-ProteinID: XP_007268404
JGI: Fomme1_110692
LinkDB All DBs
Position
Unknown
AA seq 612 aa AA seqDB search
MDRKSRVAIFLQDACYKHQFIRSNDVSRIVERPERLRALKLGFAAAIARIEEVATGTNKG
PINEHKDAVVRSTEDELVAALEKLDMQHDVNVVDIISSSSSVDILNNKAVKFVHGDIEGD
VYLENLIKWAKESTDKVQLGESEIPSHLSQGDLYRAYLTSLTCNFPYYLLQLVCPGSLDA
IQGALGTVCEAVDAILGMPQHDGESLKAAPTNAFVAIRPPGHHCGEDSPSGFCFMNNVVV
AAAHAHLTHGVKKVIIFDIDLHHGNGTQELAWQINEETYRQTLETESAASETSSGLQIFY
GSLHDVLSFPCEDGNKSIIQAASVSIHGLHGQHIENIHLQEYQSEEDFWKNLYPQQYSKL
IKKAEDFVKDTNKEDVLVFISCGFDACEHEYPSMSRHNRRVPTSFYFRFAVDANNFANRF
ANGKLISVLEGGYSDRALISGGMAHISGLVDAVSLGAEINEEWWSVPNLTLLEKVLKKRR
GKASVGGDGEKWLERTNAIFDSIETVMTPSPSKAQTHVPPSSRTLRERKPASSNASPIGS
PQAQRRTKAKVTLAGKVPGGAMTPRSESVDDVTKRLEGLELEKTNVPVEGTMSDTVKKVP
RVILRVKDPNES
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggacaggaaatccagagtagctattttccttcaagacgcctgttataagcatcagttc
atccgttcaaacgatgtatcaagaattgttgaacggcctgaacggttgcgtgccttaaag
ctcggattcgcagcagcaatcgcacgcatagaagaggtcgcaacagggactaataaaggt
cccataaatgaacacaaggacgctgtcgtgcgtagcaccgaagatgaactagtcgccgct
ttggagaagctggacatgcagcatgacgtgaacgtcgttgatattatttccagctccagc
tccgtagacatccttaacaataaagccgtgaagtttgtacatggcgatatcgaaggcgac
gtttacttggagaatttaattaaatgggctaaggagagtacagataaagttcagctcggt
gaatcagagattccttcacacttgtcccaaggcgatctgtatcgtgcgtatcttacttca
cttacttgtaacttcccttactatcttcttcaattagtctgccctgggtcccttgatgcg
atccaaggtgcgctaggtaccgtttgcgaagctgtagatgcgatattgggtatgccgcaa
cacgatggtgaatcattgaaggctgctccaacgaatgcatttgttgctatacgtccacct
gggcaccactgcggggaagactcgccctctgggttttgtttcatgaacaatgtggttgtt
gcagccgcacatgcacatctaactcatggcgtcaagaaagtcatcatttttgatattgat
ttacatcatggaaacggtacccaagagctcgcgtggcaaattaatgaggaaacataccgt
caaacattggaaactgaatcagccgcttctgagacgtcatcaggccttcagatcttctac
ggttctcttcacgatgtattatccttcccatgcgaggatgggaataagtctattattcag
gctgcctctgtttcaattcatggattgcatggacaacacattgaaaatattcatctgcaa
gagtatcaatcagaggaagacttttggaagaacctctacccacagcaatattcgaagctt
ataaagaaggcagaagactttgtcaaagacacgaacaaagaagatgtcctcgtctttata
agctgtggtttcgatgcatgcgagcatgaatatccttctatgtcacgacataatcgaagg
gtaccgacgtccttctacttccgcttcgcggtagatgcgaacaacttcgcaaacagattc
gccaacgggaaactcataagcgtcttggaaggaggctacagcgaccgcgctctgataagt
ggcggaatggcccatatctcaggcttagttgatgcagtatctcttggcgcagagatcaat
gaagagtggtggagcgtgccgaacttgactttgcttgaaaaagtgttgaaaaagcgacgc
ggaaaggcctctgtcggaggcgatggagagaagtggcttgagcggaccaatgccatcttt
gattctatagagacggtgatgactccttccccatcgaaggcccagacgcatgttccgcca
tcgtccaggactttacgagagcgcaagcctgcaagctcaaatgccagtcctataggctca
ccacaggcgcagcgtcggacgaaagcgaaagtaacacttgctgggaaagttccgggtggc
gctatgacgccacgaagtgaatctgtcgatgatgtgacgaagagactagaaggcttagaa
cttgagaagactaacgtgccggtggaaggtaccatgtcggacactgtgaagaaagtaccg
cgtgtcattcttcgcgtgaaggaccctaacgaatcttaa

DBGET integrated database retrieval system