KEGG   Fomitiporia mediterranea: FOMMEDRAFT_114743Help
Entry
FOMMEDRAFT_114743 CDS       T03132                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase complex E1 component mitochondrial precursor
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
fme  Fomitiporia mediterranea
Pathway
fme00310  Lysine degradation
fme00380  Tryptophan metabolism
fme01100  Metabolic pathways
fme01110  Biosynthesis of secondary metabolites
fme01130  Biosynthesis of antibiotics
fme01200  Carbon metabolism
Module
fme_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fme_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FOMMEDRAFT_114743
  09105 Amino acid metabolism
   00310 Lysine degradation
    FOMMEDRAFT_114743
   00380 Tryptophan metabolism
    FOMMEDRAFT_114743
Enzymes [BR:fme01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     FOMMEDRAFT_114743
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N TPR_17
Motif
Other DBs
NCBI-GeneID: 18670828
NCBI-ProteinID: XP_007271791
JGI: Fomme1_114743
LinkDB All DBs
Position
Unknown
AA seq 994 aa AA seqDB search
MLRRQVLRSLACRRGPTLRSARYLATAAPPSPNDAFANGTNAYYVDEMYRHWRQDPKSVH
ASWDAYFSGMDKGLPSHEAFQPPPTFLPQPVGGAPTLNASGGAKLDDHLKVQLLVRAYQV
RGHHVADLDPLGILDADLADVRPPELELSQYGFTEADLDKQIALGPGILPHFATEDRKTM
SLREIIRLCQRIYCGAVGIQYVHIPDKDQCDWIRERVEIPKPWNYTVDEKRMILDRLMWS
ESFEKFIASKYPNEKRFGLEGCEALIPGMKALIDRSVEHGVKHVTLGMPHRGRLNVLANV
IRKPIEAILNEFSGTADPDDWPAGDVKYHLGANYVRPTPSGKKVSLSLVANPSHLEASDP
VVLGKTRAIQHFEHDEINHTTAMGVLLHGDAAFAGQGVVYETMGFQNLPCYGTGGTIHLI
INNQIGFTTDPRFARSTAYPSDIAKCIDAPIFHVNGDNVEAVTFVCQLAADYRAKYKKDV
VLDIVCYRRYGHNETDQPSFTQPRMYKAIQRQPTPLTKYTKFLIDRGTFTEKDIAEHKEW
VWGMLEKAAAAAKDYTPTSKEWLSASWQGFPSPKQLAEQTLPTRATGSSEELLKRIGKAI
STYPEGFTVHRNLARILSNRGKTVEEGTNIDWATAEALAFGSLVLEKTHVRVSGQDVERG
TFSQRHAVLHDQENEQQYVPLNNLGSNQARFVVCNSSLSEFGALGFELGYSLVSPDNLTI
WEAQFGDFANNAQCIIDQYIASGERKWLQRTGLVMSLPHGYDGQGPEHSSGRIERFLQLC
DDHPDVFPTAQKIERQHQDCNMQIVYPSTPANYFHVLRRQIKRDFRKPLILFFSKSLLRH
PKARSDLKEMTDDTHFERYLPEASEDLVAPEDIRRHILCSGQVYYTLLQERQEKGIKDVA
ISRLEQISPFPYDLITPHLDKYPNADLLWCQEEPLNNGAWTYVAPRILTAANETVHHKGK
HPLYAGREPTSSVATGSKQLHYKEIEQFLAAAFN
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcaggcaggtcctccgcagcttggcctgtcgccgcggtccgacactccgttca
gcgcggtacctggccacggccgccccgccttctcctaatgacgcgtttgccaatggcacc
aacgcatactacgtcgatgagatgtaccgtcattggcggcaggatcccaagtcagttcat
gcctcttgggatgcttatttctccggcatggacaagggcctcccgagccatgaggccttc
caacctcctcccaccttccttccgcaacccgttggcggagcccctactctaaatgccagc
ggaggtgcaaaattagatgaccatctcaaggtccaattgctcgtgcgagcgtaccaagtt
cgtggacatcatgttgcagatcttgaccctttaggcatcctggatgcagacctagccgac
gttagacctccagaattagagctgagccagtatggattcaccgaggccgatcttgataaa
caaatagcattaggcccgggtattcttccgcactttgccaccgaagaccggaagacaatg
tccctcagggaaattatcagactttgccagaggatatattgcggtgctgttggaattcaa
tatgtccatattcctgataaagaccagtgtgactggattcgagaacgcgtggaaattcca
aaaccttggaactacactgtggacgagaagcgtatgatcctggaccgtcttatgtggtct
gagtcgttcgagaaatttatcgctagtaaatatccgaacgagaagcgatttggactggaa
gggtgtgaagctctcattccgggaatgaaggctttaatcgaccgctcagtcgaacatggc
gtcaagcacgtcacccttgggatgcctcaccgtggtaggctgaatgtcctggcgaatgtc
attcgaaaaccaatcgaagctatcttgaatgaattctctggaactgccgatcccgacgat
tggccagctggagatgtaaagtaccaccttggcgcgaactatgttaggccaacaccgtct
ggaaagaaggtttcgttatcgttggtagcgaacccttctcacctggaggctagtgatcct
gtggtattgggcaagactcgagcgatccagcactttgaacacgacgaaataaaccatact
acggcgatgggtgtcttgcttcatggtgatgcggcatttgcaggtcaaggcgttgtctac
gagacgatgggcttccaaaaccttccttgttatggtaccggcggcacaattcatttgatt
attaacaatcaaattggcttcacgaccgacccacgcttcgcgcgctcgaccgcttatcct
tcggatattgccaagtgcattgacgcgcccatattccatgtgaacggtgacaatgttgaa
gcagtgactttcgtctgtcagctcgctgccgattatcgtgccaaatacaagaaggacgtc
gtccttgacatcgtctgctaccgacgttacggccataatgagacagatcagcctagtttc
actcagccaaggatgtacaaggcaatccaaagacaacccacacccttgacgaaatacacc
aagttcttgatcgatcgcgggacttttacggagaaagatatcgcggaacataaggaatgg
gtttggggtatgctcgagaaggccgcggctgccgccaaagactacacacctacaagcaag
gaatggctctctgcatcctggcaagggttcccttcaccgaagcaacttgcggaacagact
ctaccaactcgcgcgacaggttcatccgaagagttgttgaaacgtattggcaaagctatt
tctacgtatcctgaaggtttcactgtgcacagaaatcttgctcgcatcctatcaaatcgc
gggaagactgttgaagagggtaccaacatcgattgggcgactgctgaagcccttgctttc
ggttcattggttctagaaaagacacatgttcgtgtttcgggacaggatgtcgagcgtgga
acgttttcgcagagacacgcggttctccatgaccaagagaatgagcaacagtatgtccca
ctcaataacctcggctctaatcaagctcgcttcgttgtctgcaactcgtcactgtctgaa
ttcggagccctgggctttgagctcggatactcacttgtttcacccgacaacctgacgatt
tgggaggctcagtttggtgactttgccaacaacgctcaatgtattattgatcagtacatt
gcgtctggtgaaaggaagtggctccagcgaactggcctggttatgagtttaccgcatgga
tatgatggccaaggacctgagcattcgagtggacgaattgaacgtttccttcagctttgt
gatgaccatcccgatgtcttcccgacggcgcagaaaatagagagacagcaccaggattgc
aacatgcaaatcgtttacccgtcgaccccggcgaactacttccatgtacttcgacgtcag
attaagcgggatttcagaaaacctctcatccttttcttctcgaaatcactcctcagacat
cctaaggcccgctctgacttgaaggaaatgaccgatgacacgcacttcgaaagataccta
ccagaagcaagcgaagaccttgttgctcccgaagacatccgtagacacattctttgctca
ggccaagtatactacacccttcttcaagagagacaagagaagggtatcaaggacgttgct
atcagccgtctagaacaaatttcacctttcccttacgatcttattacaccgcacttggac
aagtatcctaatgctgaccttctgtggtgccaggaggaacctcttaacaacggagcctgg
acctacgtggcaccccgaatcctcactgctgctaacgagaccgtgcaccacaagggcaag
catcctctctatgcaggacgcgagcccactagctctgttgctaccggaagcaagcaactt
cactacaaagagattgagcagttcttggccgctgctttcaattag

DBGET integrated database retrieval system