KEGG   Fomitiporia mediterranea: FOMMEDRAFT_114743Help
Entry
FOMMEDRAFT_114743 CDS       T03132                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase complex E1 component mitochondrial precursor
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
fme  Fomitiporia mediterranea
Pathway
fme00020  Citrate cycle (TCA cycle)
fme00310  Lysine degradation
fme00380  Tryptophan metabolism
fme01100  Metabolic pathways
fme01110  Biosynthesis of secondary metabolites
fme01130  Biosynthesis of antibiotics
fme01200  Carbon metabolism
Module
fme_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fme_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FOMMEDRAFT_114743
  09105 Amino acid metabolism
   00310 Lysine degradation
    FOMMEDRAFT_114743
   00380 Tryptophan metabolism
    FOMMEDRAFT_114743
Enzymes [BR:fme01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     FOMMEDRAFT_114743
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N TPR_17
Motif
Other DBs
NCBI-GeneID: 18670828
NCBI-ProteinID: XP_007271791
JGI: Fomme1_114743
LinkDB All DBs
Position
Unknown
AA seq 994 aa AA seqDB search
MLRRQVLRSLACRRGPTLRSARYLATAAPPSPNDAFANGTNAYYVDEMYRHWRQDPKSVH
ASWDAYFSGMDKGLPSHEAFQPPPTFLPQPVGGAPTLNASGGAKLDDHLKVQLLVRAYQV
RGHHVADLDPLGILDADLADVRPPELELSQYGFTEADLDKQIALGPGILPHFATEDRKTM
SLREIIRLCQRIYCGAVGIQYVHIPDKDQCDWIRERVEIPKPWNYTVDEKRMILDRLMWS
ESFEKFIASKYPNEKRFGLEGCEALIPGMKALIDRSVEHGVKHVTLGMPHRGRLNVLANV
IRKPIEAILNEFSGTADPDDWPAGDVKYHLGANYVRPTPSGKKVSLSLVANPSHLEASDP
VVLGKTRAIQHFEHDEINHTTAMGVLLHGDAAFAGQGVVYETMGFQNLPCYGTGGTIHLI
INNQIGFTTDPRFARSTAYPSDIAKCIDAPIFHVNGDNVEAVTFVCQLAADYRAKYKKDV
VLDIVCYRRYGHNETDQPSFTQPRMYKAIQRQPTPLTKYTKFLIDRGTFTEKDIAEHKEW
VWGMLEKAAAAAKDYTPTSKEWLSASWQGFPSPKQLAEQTLPTRATGSSEELLKRIGKAI
STYPEGFTVHRNLARILSNRGKTVEEGTNIDWATAEALAFGSLVLEKTHVRVSGQDVERG
TFSQRHAVLHDQENEQQYVPLNNLGSNQARFVVCNSSLSEFGALGFELGYSLVSPDNLTI
WEAQFGDFANNAQCIIDQYIASGERKWLQRTGLVMSLPHGYDGQGPEHSSGRIERFLQLC
DDHPDVFPTAQKIERQHQDCNMQIVYPSTPANYFHVLRRQIKRDFRKPLILFFSKSLLRH
PKARSDLKEMTDDTHFERYLPEASEDLVAPEDIRRHILCSGQVYYTLLQERQEKGIKDVA
ISRLEQISPFPYDLITPHLDKYPNADLLWCQEEPLNNGAWTYVAPRILTAANETVHHKGK
HPLYAGREPTSSVATGSKQLHYKEIEQFLAAAFN
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcaggcaggtcctccgcagcttggcctgtcgccgcggtccgacactccgttca
gcgcggtacctggccacggccgccccgccttctcctaatgacgcgtttgccaatggcacc
aacgcatactacgtcgatgagatgtaccgtcattggcggcaggatcccaagtcagttcat
gcctcttgggatgcttatttctccggcatggacaagggcctcccgagccatgaggccttc
caacctcctcccaccttccttccgcaacccgttggcggagcccctactctaaatgccagc
ggaggtgcaaaattagatgaccatctcaaggtccaattgctcgtgcgagcgtaccaagtt
cgtggacatcatgttgcagatcttgaccctttaggcatcctggatgcagacctagccgac
gttagacctccagaattagagctgagccagtatggattcaccgaggccgatcttgataaa
caaatagcattaggcccgggtattcttccgcactttgccaccgaagaccggaagacaatg
tccctcagggaaattatcagactttgccagaggatatattgcggtgctgttggaattcaa
tatgtccatattcctgataaagaccagtgtgactggattcgagaacgcgtggaaattcca
aaaccttggaactacactgtggacgagaagcgtatgatcctggaccgtcttatgtggtct
gagtcgttcgagaaatttatcgctagtaaatatccgaacgagaagcgatttggactggaa
gggtgtgaagctctcattccgggaatgaaggctttaatcgaccgctcagtcgaacatggc
gtcaagcacgtcacccttgggatgcctcaccgtggtaggctgaatgtcctggcgaatgtc
attcgaaaaccaatcgaagctatcttgaatgaattctctggaactgccgatcccgacgat
tggccagctggagatgtaaagtaccaccttggcgcgaactatgttaggccaacaccgtct
ggaaagaaggtttcgttatcgttggtagcgaacccttctcacctggaggctagtgatcct
gtggtattgggcaagactcgagcgatccagcactttgaacacgacgaaataaaccatact
acggcgatgggtgtcttgcttcatggtgatgcggcatttgcaggtcaaggcgttgtctac
gagacgatgggcttccaaaaccttccttgttatggtaccggcggcacaattcatttgatt
attaacaatcaaattggcttcacgaccgacccacgcttcgcgcgctcgaccgcttatcct
tcggatattgccaagtgcattgacgcgcccatattccatgtgaacggtgacaatgttgaa
gcagtgactttcgtctgtcagctcgctgccgattatcgtgccaaatacaagaaggacgtc
gtccttgacatcgtctgctaccgacgttacggccataatgagacagatcagcctagtttc
actcagccaaggatgtacaaggcaatccaaagacaacccacacccttgacgaaatacacc
aagttcttgatcgatcgcgggacttttacggagaaagatatcgcggaacataaggaatgg
gtttggggtatgctcgagaaggccgcggctgccgccaaagactacacacctacaagcaag
gaatggctctctgcatcctggcaagggttcccttcaccgaagcaacttgcggaacagact
ctaccaactcgcgcgacaggttcatccgaagagttgttgaaacgtattggcaaagctatt
tctacgtatcctgaaggtttcactgtgcacagaaatcttgctcgcatcctatcaaatcgc
gggaagactgttgaagagggtaccaacatcgattgggcgactgctgaagcccttgctttc
ggttcattggttctagaaaagacacatgttcgtgtttcgggacaggatgtcgagcgtgga
acgttttcgcagagacacgcggttctccatgaccaagagaatgagcaacagtatgtccca
ctcaataacctcggctctaatcaagctcgcttcgttgtctgcaactcgtcactgtctgaa
ttcggagccctgggctttgagctcggatactcacttgtttcacccgacaacctgacgatt
tgggaggctcagtttggtgactttgccaacaacgctcaatgtattattgatcagtacatt
gcgtctggtgaaaggaagtggctccagcgaactggcctggttatgagtttaccgcatgga
tatgatggccaaggacctgagcattcgagtggacgaattgaacgtttccttcagctttgt
gatgaccatcccgatgtcttcccgacggcgcagaaaatagagagacagcaccaggattgc
aacatgcaaatcgtttacccgtcgaccccggcgaactacttccatgtacttcgacgtcag
attaagcgggatttcagaaaacctctcatccttttcttctcgaaatcactcctcagacat
cctaaggcccgctctgacttgaaggaaatgaccgatgacacgcacttcgaaagataccta
ccagaagcaagcgaagaccttgttgctcccgaagacatccgtagacacattctttgctca
ggccaagtatactacacccttcttcaagagagacaagagaagggtatcaaggacgttgct
atcagccgtctagaacaaatttcacctttcccttacgatcttattacaccgcacttggac
aagtatcctaatgctgaccttctgtggtgccaggaggaacctcttaacaacggagcctgg
acctacgtggcaccccgaatcctcactgctgctaacgagaccgtgcaccacaagggcaag
catcctctctatgcaggacgcgagcccactagctctgttgctaccggaagcaagcaactt
cactacaaagagattgagcagttcttggccgctgctttcaattag

DBGET integrated database retrieval system