KEGG   Fomitiporia mediterranea: FOMMEDRAFT_132925Help
Entry
FOMMEDRAFT_132925 CDS       T03132                                 

Definition
(RefSeq) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
fme  Fomitiporia mediterranea
Pathway
fme00500  Starch and sucrose metabolism
fme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fme00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FOMMEDRAFT_132925
Enzymes [BR:fme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     FOMMEDRAFT_132925
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase DUF1966
Motif
Other DBs
NCBI-GeneID: 18671807
NCBI-ProteinID: XP_007265037
JGI: Fomme1_132925
LinkDB All DBs
Position
Unknown
AA seq 487 aa AA seqDB search
MRATTALTLQALVLSAFAATADQWRSRSIYQIMTDRFALGNGTYPPCNTTERTYCGGNWR
GIINNLDYIQGMGFDAVWISPISTTVNITAEGHSYHGYWTGDLDTLNKHFGDETDLKGLV
SELHSREMYLMLDVNVNHMGSNSTPANVSWLLPFMNESNYHQQCSIDDQNNQWQLENCWL
NSGQVLLPDINTENQTIVDMLNTWVNYTVDRFNFDGIRINAAKHVRKDFWPAFAANASVF
TLGEVMSNDTDYTANYTTVMSNVLDYPSYYQLQQAFSKPGGDISGLVGVLRNVQQKFKEG
AFGSGLFMENHDQPRFQSLTQDQSLVKNAMVWTFATDAMPIVFYGQEQGFEGLQAPDNHG
ALWLTGMKKTGPLIEHITALNKARKLAALAEPKFHSTAVKVVASSNGTVALSKPPMLSLI
SNSGNMSMPSWNVNGSDSGFAPGTRLVDILSCNTITTGSDGSVAAHSKAGLPLVLLPQSA
LSLASTH
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgctactacggctctcacccttcaagctcttgtgctttccgctttcgccgccact
gcagatcagtggaggtcgcgatctatttaccagatcatgacagaccgcttcgctctcggc
aacggaacctatccaccgtgcaatacgaccgagcgaacttactgtggcggaaactggcgc
ggcataatcaacaacctcgactacattcagggcatgggcttcgatgcggtctggatttca
cctatttcaaccaccgttaacatcaccgcagaggggcattcgtatcacgggtactggact
ggagacctcgataccctcaacaagcatttcggcgatgagacagacctgaaaggacttgtc
tcggagctgcattcgcgtgagatgtatctcatgctggacgtcaatgtgaaccacatgggc
tcgaactctactccggcgaacgtctcatggctgcttccatttatgaatgagtcgaattac
catcaacaatgctcaatagatgaccagaataaccagtggcagcttgagaactgctggctc
aacagtggtcaggtcctcctacccgatattaacacggagaaccagacgatcgtcgacatg
ctcaatacgtgggtcaactatactgttgacaggttcaattttgacggtattcgcatcaat
gccgctaaacacgtccgtaaggacttctggcctgcttttgctgcgaacgctagcgtgttc
acgttaggtgaggtcatgagcaacgataccgactatacggcaaattacacgaccgtcatg
tccaacgttctcgactacccaagctattatcagctccagcaagctttctcgaagccgggc
ggtgacatttctggactcgtcggcgtacttcgtaatgtccagcagaaattcaaagaaggt
gctttcggttcaggcttatttatggagaaccatgaccagcctcgcttccagtcactaaca
caagaccagtctctcgtaaagaacgctatggtatggacgtttgcaacagatgccatgccg
atcgttttctatgggcaagaacaaggcttcgaaggtttgcaggcccccgacaaccacggt
gctctctggctgactggtatgaagaagactggacctctgatcgaacatattactgctctc
aacaaggcacgcaagcttgcagcactcgcagaaccgaagttccactcaacggctgtcaag
gttgtcgcttctagcaatggtacagtggcactgagtaaaccacccatgctctctctcatt
tcaaacagtgggaacatgtctatgccttcttggaacgtcaacggttctgactcgggcttt
gcacctggtacaaggcttgtcgacattctctcctgcaacactatcacaaccggttcagat
ggtagtgtcgcagctcattctaaagcaggtcttccgcttgtcctcctccctcagtccgca
ttgtccttggctagtactcactga

DBGET integrated database retrieval system