KEGG   Fomitiporia mediterranea: FOMMEDRAFT_16963Help
Entry
FOMMEDRAFT_16963  CDS       T03132                                 

Definition
(RefSeq) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
fme  Fomitiporia mediterranea
Pathway
fme00020  Citrate cycle (TCA cycle)
fme00480  Glutathione metabolism
fme01100  Metabolic pathways
fme01110  Biosynthesis of secondary metabolites
fme01130  Biosynthesis of antibiotics
fme01200  Carbon metabolism
fme01210  2-Oxocarboxylic acid metabolism
fme01230  Biosynthesis of amino acids
fme04146  Peroxisome
Module
fme_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fme_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:fme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FOMMEDRAFT_16963
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    FOMMEDRAFT_16963
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    FOMMEDRAFT_16963
Enzymes [BR:fme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     FOMMEDRAFT_16963
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 18677018
NCBI-ProteinID: XP_007262628
JGI: Fomme1_16963
LinkDB All DBs
Position
Unknown
AA seq 418 aa AA seqDB search
MATGVPFDRIVVKNPVVELDGDEMTRIIWKKIREELILPYLQLDIKYYDLGIENRDATDD
QVTIDSAEAIKEYNVGIKCATITPDEARVEEFKLKQMWRSPNGTIRNILGGTVFREPIVL
NKIPKPVPGWKKPIVIGRHAFGDQYRSTDFVAPGPGKLQLVFTPPEGEKTVLDVYDFKGP
GVAMSMYNTDESISGFAHSSFKMALQKKLPLFLSTKNTIMKKYDGRFKDIFQELYDTHYK
PLFDESSIYYEHRLIDDMVAQAIKSSGGFVWSCKNYDGDVQSDILAQGFGSLGMMTSELV
TPDGKTIEAEAAHGTVTRHFREHQKGRETSTNPVASIFAWTRGLLHRAKLDKNDALANFC
RNLEAACVEVIDEDGVMTKDLALAIHGKEMLREHWVVTDVYMDAVNKKLQKKLAESLA
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggctactggtgtaccgtttgatagaattgtggttaagaaccctgttgttgaacttgat
ggagatgagatgacgagaattatttggaagaagattcgtgaggagttgattttgccatat
ttacaacttgatatcaagtattatgaccttggtattgagaatagggatgctacggatgac
caggtgaccatcgattctgctgaagcaatcaaggaatacaacgtcggtatcaaatgcgca
accatcactccagacgaagctcgcgtagaagaattcaagctcaaacaaatgtggcgttct
ccaaacggtacgatccgaaacattcttggcggtacagtcttccgagagcccattgtgctg
aacaagattccgaagcccgtaccggggtggaagaaaccgattgtcatcggtcgtcatgcg
tttggtgatcaatatcgtagcacggactttgttgcgcctggaccgggcaagttgcagttg
gtgttcacccctccagagggtgagaagaccgtgttggacgtgtatgatttcaagggaccg
ggggtggcaatgagtatgtataacactgatgagtcaatttcgggctttgcgcattcgtcg
ttcaagatggcattgcagaagaagcttcctctattcctctccacgaagaacacgatcatg
aagaaatacgatggtcgcttcaaggatatattccaagagctctacgacacacattataag
cctctcttcgacgaatcgtcgatctactacgaacatcgccttatcgatgacatggttgcg
caagcgatcaaatcgtcgggtggcttcgtgtggtcctgtaagaactacgatggtgacgtg
cagtccgacattctcgcgcaaggattcggaagtctgggaatgatgacgagtgaacttgtt
actcctgatgggaagactatcgaagctgaagctgcgcacggaaccgtgacccgacacttc
cgcgaacaccaaaaaggtagagaaacatccacgaacccagtagcatccatcttcgcatgg
acgcgtggtctcctacaccgcgcgaaactcgacaagaacgacgcactagcgaatttctgc
cggaacctcgaagcggcatgcgtggaagtgattgatgaagatggggtgatgacgaaggac
cttgcgcttgcgatacacgggaaggagatgctccgtgaacattgggtcgtgacggatgtt
tatatggatgctgttaataaaaagttgcagaagaagctcgcagagtccctggcatga

DBGET integrated database retrieval system