KEGG   Fomitiporia mediterranea: FOMMEDRAFT_19850Help
Entry
FOMMEDRAFT_19850  CDS       T03132                                 

Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
fme  Fomitiporia mediterranea
Pathway
fme00052  Galactose metabolism
fme00500  Starch and sucrose metabolism
fme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    FOMMEDRAFT_19850
   00500 Starch and sucrose metabolism
    FOMMEDRAFT_19850
Enzymes [BR:fme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     FOMMEDRAFT_19850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 18677790
NCBI-ProteinID: XP_007266231
JGI: Fomme1_19850
LinkDB All DBs
Position
Unknown
AA seq 998 aa AA seqDB search
MNRVRLSALSLLFATQCIAGAWAALLPRAVDDTAHSLNVSTCPGYTLQDLQNTSSGFTAS
LALAGPACNAFGNDIANLTIAVDYESQSRLHVHIFDTANQQFQIPESVITRPSFDSTEQS
ESDLEFHYNSAPFEFWITRRSDSPDAAPLFDTRKASLPPTPVPPLNAGDNRTAFDGFSLV
FEDQYLQLTSALPLNTNIYGLGEAVASSGIRRDVGVGNSSNGGLGTIQTMWARDVADPID
GNMYGMHAVYMEHRFDESTASSKSHGVFLLNSAGSDILLSTPPSSNTSLVQYRAIGGTLD
LYFLSGPSPKEVVQQYGEVVGLPTWQPYWGFGFHLCRWGYTNVSVTREQVTRMREANIPL
EVQWNDIDLYHAFRDFTTDPVSFPTEEVRAFIQELASNNQHYIPIVDAALAKTVNTTDVY
DPYTSGTDQKVFITNSDGSEYVGQVWPGFTVFPDWFANNTVAWWTEAFKNWSTTGGVEFS
GIWLDMNEPSSFCDGSCGSNRDITNTSTPFILPGKPGNPVTDYPEGYISSNTGSSLRSSS
RLSKLLLIQQRAAFASRSESDEENIVRFAKRGLGAGSQSGVDLNSPPYAIHNGAGRLSIN
TVATNASSAPGYAQLDIHNLFGMMEERATHLAVQDVIPGKRPFLIARSTFPSSGKWSGHW
LGDNFSQWLYMHFNIQGVLQFQMFQIPMVGADTCGFNGNTDEELCNRWMQLSAFVPFYRN
HNTLGAISQEPYRWDSVANASRIAMAVRYSMLPYWYTLFANVSTQGTPPVRALFWEFPDE
SELFAVDRQFLVGRDILVTPVLEPNATTVDGIFPGRGSVTWRDWYTHSVVNTSSTSGNAT
TATLPAPLGHINVHVRDGAILLLHAKPAYTTTETRAGPFELLITLPLSGERSAFGTSYVD
DGVSFPPGPNTTLVFQASSPNSSGTLTSTPTGAFNIEQKLTKVTILGVTTNPTKVSLQGS
AVGSASWVFNDEGKKGELIIEGDGVNVDLNKAFTIEWT
NT seq 2997 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgagttcgtttgagcgcgttgtcgttgctgtttgcgacgcaatgtatcgctggc
gcttgggccgctctgcttcctcgtgcggtggatgacacagcccattcgctgaacgtctcc
acttgtcctggatacacactccaggatctccaaaatacttcaagcggcttcacagcgtct
cttgcactcgccggtccggcgtgtaatgcattcggcaatgacattgccaaccttaccatt
gcagttgattatgaatctcagtctcggcttcacgttcacatattcgacaccgcgaaccaa
caattccaaattcccgaatccgtaatcacacgtccttcgttcgactcgacagaacaatcg
gaatcagacctcgagttccactacaactctgcaccttttgagttttggatcacgcgtcgg
tccgattcaccggatgcggctccgttattcgatactcggaaggctagtttaccgccgact
ccggtgccacctttgaatgctggtgataatagaactgcgtttgatggtttctcacttgtt
tttgaggatcaatatcttcagttaacgagtgctttgccactcaacacaaatatctatggt
ctaggagaagccgtagcaagcagtgggatccgtcgagatgtcggagtagggaacagctcg
aacggagggctaggaactatccaaacgatgtgggctcgtgacgttgcagatccgattgac
ggaaatatgtatggaatgcatgcggtttatatggaacatcgatttgatgagagtactgcg
agttcaaagtcgcacggggtgtttttgttgaactccgccggctcagacatccttctctca
actcctccttcctcaaacacttcacttgtacaatatcgcgctatcggtgggactctcgat
ctgtatttcctgtcaggtccgagcccaaaagaggttgtgcaacagtatggtgaagtagtt
ggtttgccaacgtggcagccgtattggggattcggcttccatctttgtcgatggggatat
acgaacgtaagtgtgactcgtgaacaggttacgaggatgcgtgaggcgaatattccgctt
gaagtgcaatggaacgatatcgatttgtatcacgcattccgagacttcaccaccgacccg
gtcagtttcccgactgaggaagtgagagcgtttatccaggaattagcttcaaacaaccag
cactatataccgattgttgatgcagcgcttgcaaaaaccgtcaacactaccgatgtttat
gatccatacacatccggtacagaccaaaaggtgtttatcaccaactccgacggaagcgaa
tatgtcggacaagtctggcctggcttcacagtcttccctgactggttcgcgaacaacacg
gttgcttggtggacggaggcgtttaagaattggagtacgaccggtggagtggagttctca
gggatttggttggatatgaacgagccgagttcgttttgtgacggatcttgtggatcgaac
cgcgacatcacaaacacaagtacaccgttcatcctccctggcaaacccggaaaccctgtg
actgactatcccgaagggtacatttcttctaatacaggttcttcacttagatcgtcgagt
agactttctaaattattgttgatacaacagcgtgctgcgtttgcttctaggtctgagagt
gatgaagagaatatagtgaggtttgcgaaacgtggattgggcgctgggagtcagtcgggt
gtggatcttaatagtccgccgtatgcgatccataacggcgctggcaggctgtcgattaac
acagtcgcgacgaacgcgtcttctgcacctggatacgcacagctggacatacataactta
ttcggtatgatggaagaacgggcaacacatttagctgtacaggatgtcattccaggaaag
aggccattcttgattgctcgttcaacgttcccttcttctggtaaatggagtggacactgg
ttgggcgataactttagccagtggctgtacatgcatttcaacattcaaggcgtcctccag
ttccagatgttccagattccaatggttggagctgatacgtgtggatttaatggaaataca
gacgaagagttgtgcaaccgatggatgcagctttcggcattcgtccccttctataggaac
cataacactttaggagcaatatctcaagaaccatacagatgggacagcgttgcgaatgcg
tctcggatcgcgatggctgtgaggtattcgatgctgccatactggtatacgcttttcgcg
aacgtgtcgactcaaggaactccacccgttcgagcgctgttttgggagttccccgatgaa
tccgagttgttcgcggtggatcgacagtttttggttggacgtgatattcttgttactccc
gttcttgagccgaacgctacgactgttgatgggatcttccccggccgcggaagcgtaaca
tggcgcgattggtacacgcactccgttgtcaatacctcatcgacgagtggaaatgcaaca
actgctacacttcccgcacctctgggacacataaacgtacacgtacgggacggcgctata
ttgctcttgcacgcgaaaccggcgtatacaacgactgagacaagagcgggaccgttcgaa
ctgctcattactcttcctctctccggtgagaggagtgctttcggaacgagttacgtagat
gatggagtctcattccctcctggcccgaatactacactcgtcttccaagcatcttccccc
aattcgtcgggaacgctcacttccacgccaactggtgcgttcaacattgagcagaagttg
acgaaggttaccatcctcggtgtaacgacgaacccgacgaaagtttcgctacagggaagt
gcggtcgggagcgctagttgggtgtttaatgatgaaggcaagaagggagaattgatcatc
gaaggggacggggtgaatgttgatttgaataaggcgttcacaattgagtggacataa

DBGET integrated database retrieval system